VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

lipL32

Gene Name lipL32
Sequence Strain (Species/Organism) Leptospira mayottensis 200901116
NCBI Protein GI AEZ53269
Other Database IDs CDD:288920
Taxonomy ID 1192864
Protein Name LipL32
Protein pI 4.31
Protein Weight 16281.3
Protein Length 225
Protein Note Leptospira cf. borgpetersenii
Protein Sequence
>AEZ53269.1 LipL32, partial [Leptospira mayottensis 200901116]
ISVALFASITACGAFGGLPSLKSSFVLSESTVPGTNETVKTFLPYGTVINYYGYIKPGQAPDGLVDGSKK
AYYLYVWVPAVIAEMGVRMISPTGEIGEPGDGDLVSDAFKAATPEEKSMPNWFDTWIRVERMSAIMPDQI
AKAAKAKPVQKLDDDDDG

Molecule Role Protective antigen
Molecule Role Annotation (Lin et al., 2016)
References