VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

lipL45

Gene Name lipL45
Sequence Strain (Species/Organism) Leptospira interrogans serovar Lai str. 56601]
NCBI Protein GI AAN49494
Other Database IDs CDD:309765
CDD:331332
Taxonomy ID 189518
Protein Name LipL45
Protein pI 8.37
Protein Weight 38430.65
Protein Length 462
Protein Note FecR protein; pfam04773
Protein Sequence
>AAN49494.2 LipL45 [Leptospira interrogans serovar Lai str. 56601]
MKKFLIVFSSVLTTGLLVFNACKKPTESSKAAATKGNSPSAVVVFSVGEAKILHADLTEEKAALGASLKT
GDKVSTKQKSKVDIQFADGSAIRISENSVIDFDALSINSHGNSDTRLALVSGKVFAKVNKASKEDQFSVV
TPTAIAGVRGTSFIVDRSKSDKAVVKVLDGAVAVAPRVVVLEGLSDEEIAKNEDLKKIQQTVASSEIVLE
KNQASVVKADEKSLDVKDTSKISEKNITGVVKKLDNSGISKKEEEEIRTIVTVDKDTTEKMVRLNEESSG
KVDEQKAAVLEAERKKLESEVAARQEEEAKKFKQVLISAPKELKSSKDIVNYYERIEKIIMMDGSSMIGA
IVDQQGSTMIVHTEQGIKKINQADVQEVIYDFQTKAKF

Molecule Role Protective antigen
Molecule Role Annotation (Vijayachari et al., 2015)
References