VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

loa22

Gene Name loa22
Sequence Strain (Species/Organism) Leptospira interrogans serovar Australis
NCBI Protein GI AIZ46906
Other Database IDs CDD:143586
Taxonomy ID 211882
Protein Name Loa22
Protein pI 5.36
Protein Weight 17568.17
Protein Length 240
Protein Note Peptidoglycan binding domains similar to the C-terminal domain of outer-membrane protein OmpA; cd07185
Protein Sequence
>AIZ46906.1 Loa22, partial [Leptospira interrogans serovar Australis]
SFTLCSSAEKKEESAAPEPSTQEQSAAANRNVDVNSPEAIADSLNEKLKDFRYPDGLTRPGFSYKKADVT
PGDFSEWSKTNAPVIKEGLGKLPDSYALEITGHTDAIGPEQAEGAKKGNIFYSELRANAVKQALIKQGIP
ANRIVTKGAGSSEPVSGLDAKDAKNR

Molecule Role Protective antigen
Molecule Role Annotation (Umthong et al., 2015)
References