VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Cov19VaxKB
Vaccine Mechanisms
VaximmutorDB
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign2
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

ompT

Gene Name ompT
Sequence Strain (Species/Organism) Escherichia coli
NCBI Protein GI APO18432
Other Database IDs CDD:236813
Taxonomy ID 562
Protein Name OmpT
Protein pI 7.77
Protein Weight 34939.14
Protein Length 369
Protein Note commensal strain
Protein Sequence
>APO18432.1 OmpT (plasmid) [Escherichia coli]
MYLKILATALSAPVAFAALASDTGLSFTPEKISTEIDFGTLSGKAKERVYLPEEKGRKASQLDWKYSNAP
IVKGAFNWDLLPRVSVGASGWTTLAGRGGNMVDRDWLDTSNPGTWTDESKHPNTRLNFANEFDLNIKGWL
LNQPDYQLGLMAGYQENRYSFTAKGGSYIYSSEGGFRDETGSFPDGERAIGYKQHFKMPYIGLTGNYRYD
SFEFGGSFKYSGWVKASDNDEHYNPEKRITYRSDVNNQNYYSVSLHAGYYITPAAKVYVEGTWNRITNKK
GDTSLYSRNLNISDHTKNGAGIESYNFMTTAGLKYYF

Molecule Role Protective antigen
Molecule Role Annotation recombinant antigens (rAg) vaccine combining common ExPEC surface proteins EtsC, OmpA, OmpT, and TraT showed significantly (P < 0.05) elicited IgY against specific antigens, induced immune related mRNA expression in the spleen and bursa, reduced in vitro growth of multiple APEC serotypes, and decreased bacterial loads in the heart and spleen, and gross lesion scores of the air sac, heart and liver in chickens.(Van et al., 2017)
References