VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Cov19VaxKB
Vaccine Mechanisms
VaximmutorDB
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign2
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

CFA/I

Gene Name CFA/I
Sequence Strain (Species/Organism) Escherichia coli
NCBI Protein GI AAB22177
Other Database IDs CDD:282325
Taxonomy ID 562
Protein Name colonization factor antigen I
Protein pI 5.58
Protein Weight 14379.9
Protein Length 253
Protein Note CFA/I
Protein Sequence
>AAB22177.1 colonization factor antigen I, CFA/I [Escherichia coli, H10407 (O78:H-), Peptide, 147 aa]
VEKNITVTASVDPVIDLLQADGNALPSAVKLAYSPASKTFESYRVMTQVHTNDATKKVIVKLADTPQLTD
VLNSTVQMPISVSWGGQVLSTTAKEFEAAALGYSASGVNGVSSSQELVISAAPKTAGTAPTAGNYSGVVS
LVMTLGS

Molecule Role Protective antigen
Molecule Role Annotation (Zeinalzadeh et al., 2017)
References