VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign2
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

espA

Gene Name espA
Sequence Strain (Species/Organism) Escherichia coli O157:H7
NCBI Protein GI EIP05353
Taxonomy ID 1286877
Gene Strand (Orientation) ?
Protein Name espA
Protein pI 5.13
Protein Weight 15791.36
Protein Length 206
Protein Sequence
>EIP05353.1 espA [Escherichia coli O157:H7 str. TW14313]
MFSYMYQAQSNLSIAKFADMNEASKASTTAQKMANLVDAKIADVQSSTDKNAKAKLPQDVIDYINDPRND
ISVTGIRDLSGDLSAGDLQTVKAAISAKANNLTTVVNNSQLEIQQMSNTLNLLTSARSDVQSLQYRTISA
ISLGK
Molecule Role Protective antigen
Molecule Role Annotation Intranasal immunization protected against EHEC O157:H7 colonization and infection in mice at a rate of 90% (Lin et al., 2017).

Immunization of calves with recombinant EHEC O157 EspA, intimin and Tir resulted in the generation of antibodies capable of cross-reacting with antigens from non-O157 EHEC serotypes, suggesting that immunization with these antigens may provide a degree of cross-protection against other EHEC serotypes (McNeilly et al., 2015).
Related Vaccines(s) EspA-Tir-M novel fusion protein vaccine
References