VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign2
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

etpA

Gene Name etpA
Sequence Strain (Species/Organism) Escherichia coli
NCBI Protein GI AAX13509
Other Database IDs CDD:289765
CDD:297026
CDD:225751
Taxonomy ID 316401
Gene Strand (Orientation) ?
Protein Name EtpA
Protein pI 10.25
Protein Weight 170560.242
Protein Length 1852
Protein Note enterotoxigenic Escherichia coli (ETEC);
pSC1 is the putative plasmid on which these genes reside
Protein Sequence
>AAX13509.2 EtpA (plasmid) [Escherichia coli ETEC H10407]
MNRIYKLKFDKRRNELVVVSEITTGVGNAKATGSVEGEKSPRRGVRAMALSLLSGMMIMAHPAMSANLPT
GGQIVAGSGSIQTPSGNQMNIHQNSQNMVANWNSFDIGKGNTVQFDQPSSSAVALNRVVGGGESQIMGNL
KANGQVFLVNPNGVLFGEGASVSTSGFVASTRDIKNDDFMNRRYTFSGGQKAGAAIVNQGELTTNAGGYI
VLAADRVSNSGTIRTPGGKTVLAASERITLQLDNGGLMSVQVTGDVVNALVENRGLVSARDGQVYLTALG
RGMLMNTVLNVSGVVEASGMHRQDGNIVLDGGDSGVVHLSGTLQADNASGQGGKVVVQGKNILLDKGSNI
TATGGQGGGEVYVGGGWQGKDSNIRNADKVVMQGGARIDVSATQQGNGGTAVLWSDSYTNFHGQISAKGG
ETGGNGGRVETSSHGNLQAFGTVSASAKKGKAGNWLLDSADITIVNGSNVSKTETTQSPPHTQFAPTAAG
SAVSNTSINNRLNNGTSVTILTHRTRTGTAQGGNITVNAAINKSNGSDVNLTLQAGGNITVNNSITSTEG
KLNVNLSGARTSNGSITISNNANITTNGGDITVGTTNTSNRVNISINNTTLNASNGNIQLTGTGTDSGIL
FAGNNRLTASNIALTGNSTSGNAINLTGTATLNATNNITLTGSSTSGNAINLKGNNTLTASNITLTGEST
SGNAINLTDTTGTTTLNATNNITMQGTRVQIKHSNITAGNFALNATVAGSEISNTTLTATNNINLAAKTN
SASSGVYLKDARITSTNGSITANGTATANGKATHLDGNVTLNASNGRIKLTGNGHGSASGILFAGNNRLT
ASNIALTGNSTSGNAINLTGTATLNATNDITLTGSSTSGNAINLTGTATLNATNNITLTGSSTSGNAINL
KGNNTLTASNITLTGESTSGNAINLTDTTGTTTLNATNNITMQGTRVQIKHSNITAGNFALNATVAGSEI
SNTTLTATNNINLAAKTNSASSGVYLKDARITSTNGSITANGTATANGKATHLDGNVTLNASNGRIKLTG
NGHGSASGILFAGNNRLTASNIALTGNSTSGNAINLTGTATLNATNDITLTGSSTSGNAINLTGTATLNA
TNNITLTGSSTSGNAINLKGNNTLTASNITLTGESTSGNAINLTDTTGTTTLNATNNITMQGTRVQIKHS
NITAGNFALNATVAGSEISNTTLTATNNINLAAKTNSASSGVYLKDARITSTNGSITANGTATANGKATH
LDGNVTLNASNGRIKLTGNGHGSASGILFAGNNRLTASNIALTGNSTSGNAINLTGTATLNATNDITLTG
SSTSGNAINLTGTATLNATNNITLTGSSTSGNAINLKGNNTLTASNITLTGESTSGNAINLTDTTGTTTL
NATNNITMQGTRVQIKHSNITAGNFALNATVAGSEISNTTLTATNNINLAAKTNSASSGVYLKDARITST
NGSITTNGTATANGKATHLDGNVTLNASNGRIKLTGNGHGSASGILFAGNNRLTASNIALTGNSTSGNAI
NLTGTATLNATNDITLTGSSTSGNAINLTGTATLNATNNITLTGSSTSGNAINLKGNNTLTASNITLTGE
STSGNAINLTDTTGTTTLNATNNITMQGTRVQIKHSNITAGNFALNATVAGSEISNTTLTATNNINLAAK
TNSASSGVYLKDARITSTNGSITANGTAPANDNATYLDGNVTLNASNGSIKLTGNGNGSTSGILFAGNNT
LTASNITLTGNSEVYWQ
Molecule Role Protective antigen
Molecule Role Annotation Oral vaccination with EtpA adjuvanted with dmLT afforded significant protection against small intestinal colonization, and the degree of protection correlated with fecal IgG, IgA, or total fecal antibody responses to EtpA (Luo et al., 2016).
References