VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign2
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

eseC

Gene Name eseC
Sequence Strain (Species/Organism) Edwardsiella tarda EIB201
NCBI Protein GI AAV69404
Other Database IDs CDD:237952
Taxonomy ID 636
Protein Name EseC
Protein pI 6.15
Protein Weight 50243.03
Protein Length 553
Protein Note pathogenicity island 2 effector protein SseC; Provisional
Protein Sequence
>AAV69404.1 EseC [Edwardsiella tarda]
MVRRQAAVPGDQGGNTASVHTGDRGDTAMNNITETRYTTPPLGGSGQNDSVQSQHDHPQIGAGALDPLRP
PPQRQQDHDPKREFHRPPAPRQPVTLRLAEGALNRILDIFGPRVDGKPLTVSDIERTPMEAMTLAASLLG
VKALGDNANLKALAMEIRTHGAENLRLRQNEDLRKQVEKSIEDQAKAQKAGIFSAIVDWIVSIAEVVSGI
GKILIGDFAGGAMDVAAGCAGLVKAACETLALIDKDNAEKYQSIADVAGKVQLAFEIAGMAVDLVSVGRG
VMASKSIAKATETVMEGAAGEALHTAVTQGSETAIKTAASEIGKQVAEQVADQVTRTLAEQSGRFLGQGH
LLEAFSKQAIEQMVTRAVEAAAKKALQSGVEMSAKELSKQVVKEVQREVIKAIVGACIDSVANNAKSTTR
STLQGVNSVYQGVITKERADLQKVIQQLINETDFMQFMLEEFEKIKKRAKEDIGSLMDGAGKALSAAADA
QQKSGAMLSNIAANIA

Molecule Role Protective antigen
Molecule Role Annotation (Song et al., 2013)
References