VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

ApxIIC

Gene Name ApxIIC
Sequence Strain (Species/Organism) Actinobacillus pleuropneumoniae
NCBI Protein GI 52630373
Other Database IDs CDD:154216
Taxonomy ID 715
Gene Strand (Orientation) ?
Protein Name ApxIIC
Protein Length 160
Protein Note biovar: 1
Protein Sequence
>gi|52630373|gb|AAU84699.1| ApxIIC [Actinobacillus pleuropneumoniae]
MMLKNDFNVLGQIAWLWANSPMHRNWSVSLLMKNVIPAIENDQYLLLVDDGFPIAYCSWAKLTLESEARY
VKDTNSLKIDDWNAGDRIWIIDWIAPFGDSSLLYKHMRQRFPYDIGRAIRIYPSKKDTGKIIYLKGGKIT
KKVAEKTFLQYEQELITALQ
Molecule Role Virmugen
Molecule Role Annotation In the present study, the gene encoding the ApxII-activating protein, apxIIC, was insertionally inactivated on the chromosome of a serovar 7 strain, HS93. Pigs vaccinated with live HS93C-Ampr via the intranasal route were protected against a cross-serovar challenge with a virulent serovar 1 strain of A. pleuropneumoniae (Prideaux et al., 1999).
Related Vaccines(s) A. pleuropneumoniae HS93C-Ampr , Actinobacillus pleuropneumoniae apxIIC and apxIVA double deletion mutant vaccine
References