VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

ygbF

Gene Name ygbF
Sequence Strain (Species/Organism) Rickettsia rickettsii
NCBI Protein GI WP_012150526
Other Database IDs CDD:224643
CDD:276809
Taxonomy ID 783
Gene Strand (Orientation) ?
Protein Name tol-pal system protein YbgF
Protein pI 9.32
Protein Weight 27854.92
Protein Length 318
Protein Note Periplasmic TolA-binding protein (function unknown) [General function prediction only]; COG1729
Protein Sequence
>WP_012150526.1 tol-pal system protein YbgF [Rickettsia rickettsii]
MKLIVLLFTFLFSMFSFGESETIKGKPLKYVANNDFENRLDEQEQEIRRLIGKVEVLQHKIDLLTQNSNI
SNQEENTEVLEAGDSKKQDVFDIALLKDMTDNAPKKPITVNKDIAPDKQAYDLALAAYKDNKLTEAKDKF
KNFIQKYPNSLLISNAYFWYGECFFKQKDYNGAAVNYLKGYKELPKGAKSSDGLLKLALSLGELKKTQEA
CNMLAKFDKEFPTNRTAASKKMAEDAKIKFGCKNK
Molecule Role Protective antigen
Molecule Role Annotation (Gong et al., 2015)
References