VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

ureC

Gene Name ureC
Sequence Strain (Species/Organism) Actinobacillus pleuropneumoniae serovar 2
NCBI Protein GI 303253439
Other Database IDs CDD:183894
CDD:30031
Taxonomy ID 754254
Gene Strand (Orientation) ?
Protein Name urease subunit alpha
Protein Length 572
Protein Note urease subunit alpha; Reviewed; PRK13207
Protein Sequence
>gi|303253439|ref|ZP_07339581.1| urease subunit alpha [Actinobacillus pleuropneumoniae serovar 2 str. 4226]
MALIIPRSQYVATYGPTVGDKVRLGDTDLWATIEQDFLTKGDECKFGGGKSVRDGMAQSSTATRDNPNVL
DFALTNVMIIDAKLGIIKADIGIRDGRIVGIGQAGNPDTMDNVTPNMIIGASTEVHNGAHLIATAGGIDT
HIHWICPQQAQHAIENGITTMIGGGSGPADGTHATTCTPGKFNIERMFQACEALPVNIGFFGKGNCSMLE
PLKEQVVAGALGLKIHEDWGATPAVIDAALKVADEMDVQVAIHTDTLNESGFLEDTMKAINGRVIHTFHT
EGAGGGHAPDIIKAAMYPNVLPASTNPTRPFTVNTIDEHLDMLMVCHHLDKRVPEDVAFADSRIRPETIA
AEDILHDMGVFSIMSSDSQAMGRVGEVVTRTWQTADKMKAQRGALGDEGNDNFRIKRYIAKYTINPAIAH
GICQYVGSLEVGKLADIVLWKPQFFGVKPEFVMKKGFISFAKMGDPNASIPTPQPVFYRPMFGANAKANT
ESAVYFVSQASVDANIKAQYGIQKETLAVKGCRDVGKKDLVHNNATPEITVDPERYEVRVDGEHITCEPA
TKVPLAQRYFLF
Molecule Role Virmugen
Molecule Role Annotation Deletions were introduced into the ureC and apxIIA genes of an Actinobacillus pleuropneumoniae serotype 2 strain by homologous recombination and counterselection. The double-mutant contains no foreign DNA, is highly attenuated, protects pigs from homologous challenge upon a single aerosol application (Tonpitak et al., 2002).
Related Vaccines(s) Actinobacillus pleuropneumoniae ureC and apxIIA double mutant deletion vaccine
References