VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

ApxIVA

Gene Name ApxIVA
Sequence Strain (Species/Organism) Actinobacillus pleuropneumoniae
NCBI Protein GI 6671152
Other Database IDs CDD:164328
CDD:116920
Taxonomy ID 715
Gene Strand (Orientation) ?
Protein Name ApxIVA
Protein Length 130
Protein Note Peptidase M10 serralysin C terminal; cl12108
Protein Sequence
>gi|6671152|gb|AAF23114.1| ApxIVA [Actinobacillus pleuropneumoniae]
DWGRNSVIDAGAGNDTVNGGYGDDTLIGGKGNDILKGSYGADTYLFSKGHGQDVIYEYSNSASSTSDIDT
LKFTDIGLSELWFSRENNDLIIKSLLSEDKVTVQNWYSHQDHKIENIRLSNEQMLVSTQV
Molecule Role Virmugen
Molecule Role Annotation A precisely defined DeltaapxIICDeltaapxIVA double-deletion mutant of A. pleuropneumoniae was constructed based on HB04C(-) by transconjugation and counterselection. The results demonstrated that the DeltaapxIICDeltaapxIVA double mutant strain was less virulent than HB04C(-). Despite attenuation of virulence, the DeltaapxIICDeltaapxIVA double mutant remains immunogenic and conferred a similar level of protective immunity to pigs against challenge with a lethal dose of a heterologous fully virulent standard serovar 1 strain of A. pleuropneumoniae (Liu et al., 2007).
Related Vaccines(s) Actinobacillus pleuropneumoniae apxIIC and apxIVA double deletion mutant vaccine
References