VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

tfbA

Gene Name tfbA
Sequence Strain (Species/Organism) Actinobacillus pleuropneumoniae
NCBI Protein GI AAA21929
Other Database IDs CDD:279621
Taxonomy ID 715
Protein Name transferrin-binding protein
Protein pI 7.6
Protein Weight 56362.89
Protein Length 630
Protein Note Transferrin binding protein-like solute binding protein; pfam01298
Protein Sequence
>AAA21929.1 transferrin-binding protein [Actinobacillus pleuropneumoniae]
MHFKLNPYALAFTSLFLVACSGGKGSFDLEDVRPNKTTGVSKEEYKDVETAKKEKEQLGELMEPALGYVV
KVPVSSFENKKVDISDIEVITNGNLDDVPYKANSSKYNYPDIKTKDSSLQYVRSGYVIDGEHSGSNEKGY
VYYKGNSPAKELPVNQLLTYTGSWDFTSNANLNNEEGRPNYLNDDYYTKFIGKRVGLVSGDAKPAKHKYT
SQFEVDFATKKMTGKLSDKEKTIYTVNADIRGNRFTGAATASDKNKGKGESYNFFSADSQSLEGGFYGPK
AEEMAGKFVANDKSLFAVFSAKHNGSNVNTVRIIDASKIDLTNFSISELNNFGDASVLIIDGKKIKLAGS
GFTNKHTIEINGKTMVAVACCSNLEYMKFGQLWQQAEGGKPENNSLFLQGERTATDKMPKGGNYKYIGTW
DAQVSKENNWVATADDDRKAGYRTEFDVDFGNKNLSGKLFDKNGVNPVFTVDAKIDGNGFTGKAKTSDEG
FALDSGSSRYENVKFNDVAVSGGFYGPTAAELGGQFHHKSENGSVGAVFGAKQQVKK

Molecule Role Protective antigen
Molecule Role Annotation (Chung et al., 2012)
References