VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

fbp54

Gene Name fbp54
Sequence Strain (Species/Organism) Streptococcus pyogenes
NCBI Protein GI AAR18990
Other Database IDs CDD:224212
CDD:283353
Taxonomy ID 1314
Protein Name fibronectin/fibrinogen-binding protein
Protein pI 8.52
Protein Weight 52434.05
Protein Length 567
Protein Note Predicted component of the ribosome quality control (RQC) complex, YloA/Tae2 family, contains fibronectin-binding (FbpA) and DUF814 domains [Translation, ribosomal structure and biogenesis]; COG1293
Protein Sequence
>AAR18990.1 fibronectin/fibrinogen-binding protein, partial [Streptococcus pyogenes]
MIMRKYLQGAVIEQLEQIDNDRIIEIKVSNKNEIGDAIQATLIIEIMGKHSNIILVDRAENKIIESIKHV
GFSQNSYRTILPGSTYIEPPKTAAVNPFTITDVPLFEILQTQELTVKSLQQHFQGLGRDTAKELAELLTT
DKLKRFREFFARPTQANLTTASFAPVLFSDSHATFETLSDMLDHFYQDKAERDRINQQASDLIHRVQTEL
DKNRNKLSKQEAELLATENAELFRQKGELLTTYLSMVPNNQDSVVLDNYYTGEKLEIALDKALTPNQNAQ
RYFKKYQKLKEAVKHLSGLIADTKQSITYFESVDYNLSQASIDDIEDIREELYQAGFLKSRQRDKRHKRK
KPEQYLASDGKTILMVGRNNLQNEELTFKMAKKGELWFHAKDIPGSHVIIKDNLDPSDEVKTDAAELAAY
YSKARLSNLVQVDMIEAKKLHKPSGAKPGFVTYTGQKTLRVTPDQAKILSMKLF

Molecule Role Protective antigen
Molecule Role Annotation (Kawabata et al., 2001)
Related Vaccines(s) S. pyogenes FBP54 Protein Vaccine
References