VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

PhtD

Gene Name PhtD
Sequence Strain (Species/Organism) Streptococcus pneumoniae
NCBI Protein GI WP_000700338
Other Database IDs CDD:273578
CDD:309414
Taxonomy ID 1313
Gene Strand (Orientation) ?
Protein Name pneumococcal histidine triad protein PhtD
Protein pI 5.29
Protein Weight 89912.36
Protein Length 936
Protein Note streptococcal histidine triad protein; TIGR01363
Protein Sequence
>WP_000700338.1 pneumococcal histidine triad protein PhtD [Streptococcus pneumoniae]
MKINKKYLAGSVAVLALSVCSYELGRHQAGQVKKESNRVSYIDGDQAGQKAENLTPDEVSKREGINAEQI
VIKITDQGYVTSHGDHYHYYNGKVPYDAIISEELLMKDPNYQLKDSDIVNEIKGGYVIKVDGKYYVYLKD
AAHADNIRTKEEIKRQKQERSHNHNSRADNAVAAARAQGRYTTDDGYIFNASDIIEDTGDAYIVPHGNHF
HYIPKSDLSASELAAAQAYWNGKQGSRPSSSSSHNANPAQPRLSENHNLTVTPTYHQNQGENISSLLREL
YAKPLSERHVESDGLIFDPAQITSRTARGVAVPHGNHYHFIPYEQMSELEERIARIIPLRYRSNHWVPDS
RPEEPSPQPTPKPSPSPQPAPNPQPAPSNPIDEKLVKEAVRKVGDGYVFEENGVSRYIPAKDLSAETAAG
IDSKLAKQESLSHKLGTKKTDLPSSDREFYNKAYDLLARIHQDLLDNKGRQVDFEALDNLLERLKDVSSD
KVKLVEDILAFLAPIRHPERLGKPNAQITYTDDEIQVAKLAGKYTTEDGYIFDPRDITSDEGDAYVTPHM
THSHWIKKDSLSEAERAAAQAYAKEKGLTPPSTDHQDSGNTEAKGAEAIYNRVKAAKKVPLDRMPYNLQY
TVEVKNGSLIIPHYDHYHNIKFEWFDEGLYEAPKGYTLEDLLATVKYYVEHPNERPHSDNGFGNASDHVR
KNKADQDSKPDEDKGHDEVSEPTHPESDEKENHAGLNPSADNLYKPSTDTEETEEEAEDTTDETEIPQVE
NSVINAKIAEAEALLEKVTDSSIRQNAMETLTGLKSSLLLGTKDNNTISAEVDSLLALLKKSQPAPIQ
Molecule Role Protective antigen
Molecule Role Annotation Seven proteins induced protective responses, in terms of reduced lung burdens of the serotype 3 pneumococci. Three of the protective proteins were histidine triad protein family members.(Anderson et al., 2016)
Vaccination with PhtD reduced BG7322 bacterial burdens in MEF at both 24 (p=0.05) and 48hpi (p=0.16).(Xu et al., 2017)
References