VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

phtB

Gene Name phtB
Sequence Strain (Species/Organism) Streptococcus pneumoniae
NCBI Protein GI KPL42694
Other Database IDs CDD:273578; CDD:282170; CDD:293251; CDD:114603
Taxonomy ID 257758
Gene Strand (Orientation) ?
Protein Name pneumococcal histidine triad protein B
Protein pI 5.5
Protein Weight 108278.97
Protein Length 1129
Protein Note Derived by automated computational analysis using gene prediction method: Protein Homology.
Protein Sequence
>KPL42694.1 pneumococcal histidine triad protein B [Streptococcus pseudopneumoniae]
MKINKKYLAGSVAVLALSVCSYELGRYQAGQAKKESNRVAYIDGNQAGQKAENLTPDEVSKREGINAEQI
VIKITDQGYVTSHGDHYHYYNGKVPYDAIISEELLMKDSNYQLKDSDIVNEIKGGYVIKVNGKYYVYLKD
AAHADNIRTKEEIKRQKQEHSSNHGGGSNNQAVVAARAQGRYTTDDGYIFNASDIIEDTGDAYIVPHGNH
FHYIPKSDLSASELAAAQAFLSGKGGQLSTVEYRSSRGETRSSVRTSPSETPQNLTTTPESQNENLASLL
QELYALALSQRHVESDGLVFDPAQITKRTANGVAVPHGDHFHFIPYSQMSALEEKLARNLPIGGQPVQKH
SDNTKPSSPAKPSSAIKANFNLNTQAPNRATGGAYTTDDGYVFSPTDVIEDTGDAFVVPHGNHFHYIPKS
DLSAGELAAAQAYWNGKQGSRPSSSSSHNANPAQPSLSENHNLTVTPTYHQNQGEDIPSLLRELYAKPLS
ERHVESDGLVFDPAQITNRTANGVAVPHGDHYHFIPYSQMSPLEEKLARMIAIKGQNGAVLPGMNYLKPA
PKPQAQPSTEKKQTDFTVEQVVRKVGEGYVVEIAGVSHYVFAKDLAKDKIDAIENLLSKKTQETHALVAK
KENVASRDQEFYDKAYNLLTQAHKALSENKGRVSDFQTLDKLAERLNDESSNKVKLVDDLLAFLAPITHP
ERLGKPNAQIAYTDDEIKLAKLAGKYTTEDGYIFDEHDIESDEGNAYVTPHLNHSHWIKKDSLSEAERAA
AQAYAKEKGLQAPNSTEATEAKPEATGTEAIYNRVKAEKKVPLEKIPNHLQYTVAVQNGHFIIPHFDHYH
NLKFAWFDEGLYSAPEGYTLEDLFATVKYYVEHPDQRPHSDNGWGNASDHVRKNKADQNGKPDEDKEHDE
VSEPTHSESDEKENHAGLNPSADNLYRPSTDAEETEEEAEDTTDEDEVPQVERSVIDVKIAEAETLLEKV
TDSRTRQNAMETLSGLNSSLLFGTKDSNTISAELDRLLALLKESQPTPI

Molecule Role Protective antigen
Molecule Role Annotation Seven proteins induced protective responses, in terms of reduced lung burdens of the serotype 3 pneumococci. Three of the protective proteins were histidine triad protein family members.(Anderson et al., 2016)
References