VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

NanA

Gene Name NanA
Sequence Strain (Species/Organism) Streptococcus pneumoniae
NCBI Protein GI ARD37933
Taxonomy ID 1313
Protein Name NanA
Protein pI 7.81
Protein Weight 8529.03
Protein Length 123
Protein Sequence
>ARD37933.1 NanA [Streptococcus pneumoniae]
MLLTSSVLSATSKQCFELTSSVLSTTSKQCFELTSSVLSTTSKRCFEQPVASFLVCSLIFIEYKELGNRL
FLYCVY

Molecule Role Protective antigen
Molecule Role Annotation Seven proteins induced protective responses, in terms of reduced lung burdens of the serotype 3 pneumococci. Three of the protective proteins were histidine triad protein family members (PhtB, PhtD and PhtE). Four other proteins, all bearing LPXTG linkage domains, also had activity in this model (PrtA, NanA, PavB and Eng).(Anderson et al., 2016)
References