VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

pcsB

Gene Name pcsB
Sequence Strain (Species/Organism) Streptococcus agalactiae
NCBI Protein GI CAC28144
Other Database IDs CDD:226400
CDD:226451
InterPro: IPR007921
InterPro: IPR009148
UniProtKB/TrEMBL: Q9AKA4
Taxonomy ID 1311
Protein Name PcsB protein
Protein pI 8.94
Protein Weight 42876.56
Protein Length 507
Protein Note Uncharacterized N-terminal domain of peptidoglycan hydrolase CwlO [Function unknown]; COG3883
Protein Sequence
>CAC28144.1 PcsB protein [Streptococcus agalactiae]
MKKRILSAVLVSGVTLGTAAVTVNADDFDSKIAATDSVINTLSGQQAAAQNQVTAIKGQVGALESQQSEL
EAQNAQLEAVSQQLGQEIQTLSNKIVARNESLKKQVRSAQKGNLTNYINTILNSKSVSDAVNRVVAIREV
VSANEKMLAQQEADKAALEAKQIENQNAINTVAANKQAIENNKAALATQRAQLEAAQLELSAQLTTVQNE
KASLIQAKAQAEEAARKAAEAQAAAEAKAQAEAKAQAESVAKAQAAAQVESATAPTETVQTQPRTEIKPS
NLTATSSATTVATTTATATNEPKVTQPSVVTKAVEAPKAVVSSTPRAVSKPVVRSYDSSNTYPMGQCTWG
AKSMASWVGNYWGNANQWGASARAAGYSVGTTPRVGAVAVWPYDGGGYGHVAVVTSVANNSSIQVMESNY
AGNMSIGNYRGSFNPSASGSVYYIYPN

Molecule Role Protective antigen
Molecule Role Annotation (Li et al., 2016)
References