VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

srr-1

Gene Name srr-1
Sequence Strain (Species/Organism) Streptococcus agalactiae
NCBI Protein GI AKI95824
Other Database IDs CDD:274741
CDD:275065
CDD:287406
CDD:273478
Taxonomy ID 1311
Protein Name Serine rich repeat protein 1
Protein pI 5.03
Protein Weight 103871.63
Protein Length 1163
Protein Note KxYKxGKxW signal peptide; TIGR03715
Protein Sequence
>AKI95824.1 Serine rich repeat protein 1 [Streptococcus agalactiae]
MSKKTFGKQLTVVGSKSRVKMHKSGKNWVRTIMSHFNLFKAIKGRATVEADVCVQNIEKEDRLSSGNLTY
LKGLLAAGALLGGASLTSRVYADETPVVQEQSSSVPTLAEQTEVTVKTTAVQNYQDGTVSKNIIDSNSVS
MSESASISVSESISMSMSGSISTSVSESVSTSTSESTLSSLSESASTSALKSTSVSEASNILETQASLTD
KGRESFSANQIVTESSLVTDAGKNASVSSLIEITKPKSELQTSKMSNESLITPEKPQVMIASDKTGNETL
TPTIRLKSVIQPRSMNLIALSSEMDLIPLEEVSDTEMLGKDVSSEFQKVNIALKDNTLSEPGTVKLDKSE
NLVLNFDFSIASVNEGDFFTVKLSDNLDTQGVGTTLKVQDIIDTSGQLLATGSYSPLTHNITYIWTKYAS
TLNNINAQVKLPVWPDQRKVSKTTSDKQRFTATLNNQVASIEERVQYNSPSVTEHTNVKTNVRSRIMKID
DEKQTETYITQINPEGKEMYFASGLGNLYTIIGSDGTSGSPVNLLNAEVKILKTNSKNLTDSMDQNYDST
EFEDVTSQYSYTNDGSKITIDWKTNSISSSTSYVVLVKIPKQSGVLYSTVSDINQTNGSKYFYGYTQVDG
ESDANAEKNFLSESASTSASTSASTSASASASTSASISASTSASISASTSASTSASTSASTSASMSTSTS
VSTSASTSASMSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASMSASMSASTSVSTSAS
TSASTSASTSASTSASMSASMSASTSASMSASTSASTSASMSASTSASTSASTSASTSASTSASMSASTS
ASTSASMSASTSASTSASTSASTSASTSTSTSASTSASMSASTSASTSASTSASMSASTSASISASTSAS
MSASTSASTSASTSASTSASMSASTSASTSASTSASTSASMSASTSASTSASMSASTSASTSASTSASMS
ASTSASTSASMSASTSASMSATTSASTSVSTSASTSASTSASTSSSSSVTSNSSKEKVYSALPSTGDQDY
SVTATALGLGLMTGATLLGRKKSKKDKD

Molecule Role Protective antigen
Molecule Role Annotation (Liu et al., 2013)
References