VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

5'-nucleotidase family protein

Gene Name 5'-nucleotidase family protein
Sequence Strain (Species/Organism) Streptococcus agalactiae
NCBI Protein GI ASZ01629
Other Database IDs CDD:326311
CDD:277317
CDD:308488
Taxonomy ID 1311
Protein Name 5'-nucleotidase family protein
Protein pI 8.94
Protein Weight 69797.41
Protein Length 771
Protein Note metallophosphatase superfamily, metallophosphatase domain; cl13995
Protein Sequence
>ASZ01629.1 5'-nucleotidase family protein [Streptococcus agalactiae]
MKKKIILKSSVLGLVAGTSIMFSSVFADQVGVQVIGVNDFHGALDNTGTANMPDGKVTNAGTAAQLDAYM
DDAQKDFKQTNPNGESIRVQAGDMVGASPANSGLLQDEPTVKTFNAMNVEYGTLGNHEFDEGLAEYNRIV
TGKAPAPDSNINNITKSYPHEAAKQEIVVANVIDKVNKQIPYNWKPYTIKNIPVNNKSVNVGFIGIVTKD
IPNLVLRKNYEQYEFLDEAETIVKYAKELQAKNVKAIVVLAHVPATSKDDIAEGEAAEMMKKVNQLFPEN
SVDIVFAGHNHQYTNGLVGKTRIVQALSQGKAYADVRGVLDTDTQDFIETPSAKVIAVAPGKKTGSADIQ
AIVDQANTIVKQVTEAKIGTAEVSGMITRSVDQDNVSPVGSLITEAQLAIARKSWPDIDFAMTNNGGIRA
DLLIKPDGTITWGAAQAVQPFGNILQVVEITGRDLYKALNEQYDQKQNFFLQIAGLRYTYTDNKEGGEET
PFKVVKAYKSNGEEINPDAKYKLVINDFLFGGGDGFASFRNAKLLGAINPDTEVFMAYITDLEKAGKKVS
IPNNKPKIYVTMKMVNETITQNDGTYSIIKKLYLDRQGNIVAQEIVSDTLNQTKSKSTKINPVTTIHKKQ
LHQFTAINPMRNYGKPSNSTTVKSKQLPKTNSEYGQSFLMSVFGVGLIGIALNTKKKHMK

Molecule Role Protective antigen
Molecule Role Annotation (Liu et al., 2013)
References