VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

scpA_4

Gene Name scpA_4
Sequence Strain (Species/Organism) Streptococcus agalactiae
NCBI Protein GI AMQ15511
Other Database IDs CDD:282500
CDD:173801
CDD:278510
CDD:239048
CDD:283851
Taxonomy ID 1311
Protein Name C5a peptidase precursor
Protein pI 8.96
Protein Weight 72430.19
Protein Length 796
Protein Note predicted cleavage at residue 36
Protein Sequence
>AMQ15511.1 C5a peptidase precursor [Streptococcus agalactiae]
MNTKQRFSIRKYKLGAVSVLLGTLFFLGGITNVAADSVINKPSDIAVEQQVKDSPTSIANETPTNNTSSA
LASTAQDNLVTKANNNSPTETQPVAESHSQATETFSPAANQPVESTQEVSKTPLTKQNLAVKPTPAISKE
TPQNIDSNKIITVPKVWNTGYKGEGTVVAIIDSGLDTNHDALQLNDSTKAKYQNEQQMNAAKAKAGINYG
KWYNNKVIFGHNYVDVNTELKEVKSTSHGMHVTSIATANPSKKDTNELIYGVAPEAQVMFMRVFSDEKRG
TGPALYVKAIEDAVKLGADSINLSLGGANGSLVNADDRLIKALEMARLAGVSVVIAAGNDGTFGSGASKP
SALYPDYGLIGSPSTAREAISVASYNNTTLVNKVFNIIGLENNKNLNNGLAAYADPKVSDKTFEVGKQYD
YVFVGKGNDNDYKDKTLNGKIALIERGDITFTKKVVNAINHGAVGAIIFNNKAGEANLTMSLDPEASTIP
AIFTQKEFGDVLAQKSYKIVFNNIKNKQANPNAGVLSDFSSWGLTADGQLKPDLSAPGGSIYAAINDNEY
DMMSGTSMASPHVAGATALVKQYLLKEHPELKKGDIERTVKYLLMSTAKAHLNKDTGAYTSPRQQGAGII
DVAAAVQTGLYLTGGENNYGSVTLGNIKDKISFDVTVHNINKVAKDLHYTTYLNTDQVKDGFVTLAPQQL
VHLQGKRYGLNQGKLKRLQLI

Molecule Role Protective antigen
Molecule Role Annotation (Santillan et al., 2011)
References