VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

alp3

Gene Name alp3
Sequence Strain (Species/Organism) Streptococcus agalactiae
NCBI Protein GI AKI94854
Other Database IDs CDD:309682
CDD:312387
CDD:131384
CDD:307064
Taxonomy ID 1311
Protein Name Alpha-like protein 3
Protein pI 4.78
Protein Weight 62530.04
Protein Length 698
Protein Note YSIRK type signal peptide; pfam04650
Protein Sequence
>AKI94854.1 Alpha-like protein 3 [Streptococcus agalactiae]
MFRRSKNNSYDTSQTKQRFSIKKFKFGAASVLIGLSFLSGVTQGNLNIFEESIVAASTIPGSAATLNTSI
TKNIQNGNAYIDLYDVKNGLIDPQNLIVLNPSSYSANYYIKQGAKYYSNPSEITTTGSATITFNILDETG
NPHKKADGQIDIVSVNLTIYDSTALRNRIDEVINNANDPKWSDGSRDEVLTGLEKIKKDIDNNPKTQIDI
DNKINEVNEIEKLLVVSLPDKIKYSPEAKHRTVEQHAELDAKDSIANTDELPSNSTYNWKNGHKPDTSTS
GEKDGIVEVHYPDGTVDDVNVKVTVTSKKTDNTAPTLTVTPEQQTVKVDEDITFTVTVEDENEVELGLDD
LKAKYENDIIGARVKIKYLTKESNKKVMEVTIMKATLADKGAITFTAKDKAGNQAEPKTVTINVLPLKDS
NEPKGKDQTVKVGETPKAEDSIGNLSDLPKGTTVAFETPVDTATPGDKPAKVVVTYPDGSKDTVDVTVKV
VDPRTDADKNDPAGKDQQVKVGETPKAEDSIGNLSDLPKGTTVAFETPVDTATPGDKPAKVVVTYPDGSK
DTVDVTVKVVDPRTDADKNDPAGKDQQVNGKGNKLPATGENATPFFNVAALTIISSVGLLSVSKKKED

Molecule Role Protective antigen
Molecule Role Annotation (Kvam et al., 2011)
References