VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

C protein alpha-antigen

Gene Name C protein alpha-antigen
Sequence Strain (Species/Organism) Streptococcus agalactiae
NCBI Protein GI AIF88081
Other Database IDs CDD:273479
CDD:204077
CDD:298076
CDD:279132
Taxonomy ID 1311
Protein Name C protein alpha-antigen
Protein pI 4.53
Protein Weight 108142.91
Protein Length 1263
Protein Note Gram-positive signal peptide, YSIRK family; TIGR01168
Protein Sequence
>AIF88081.1 C protein alpha-antigen [Streptococcus agalactiae]
MFRRSKNNSYDTSQTKQRFSIKKFKVGAASVLIGLSFLGGVTQGNLNIFEESIVAASTIPGSAATLNTSI
TKNIQNGNAYIDLYDVKLGKIDPLQLIVLEQGFTAKYVFRQGTKYYGDVSQLQSTGRASLTYNIFGEDGL
PHVKTDGQIDIVSVALTIYDSTTLRDKIEEVRTNANDPKWTEESRTEVLTGLDTIKTDIDNNPKTQTDID
SKIVEVNELEKLLVLSVPDKDKYDPTGGETTVPQGTPVSDKEITDLVKIPDGSKGVPTVVGDRPDTNVPG
DHKVTVDVTYPDGTKDTVEVTVHVTPKPVPDKDKYDPTGGETTVPQGTPVSDKEITDLVKIPDGSKGVPT
VVGDRPDTNVPGDHKVTVEVTYPDGTKDTVEVTVHVTPKPVPDKDKYDPTGGETTVPQGTPVSDKEITDL
VKIPDGSKGVPTVVGDRPDTNVPGDHKVTVEVTYPDGTKDTVEVTVHVTPKPVPDKDKYDPTGGETTVPQ
GTPVSDKEITDLVKIPDGSKGVPTVVGDRPDTNVPGDHKVTVDVTYPDGTKDTVEVTVHVTPKPVPDKDK
YDPTGGETTVPQGTPVSDKEITDLVKIPDGSKGVPTVVGDRPDTNVPGDHKVTVEVTYPDGTKDTVEVTV
HVTPKPVPDKDKYDPTGGETTVPQGTPVSDKEITDLVKIPDGSKGVPTVVGDRPDTNVPGDHKVTVEVTY
PDGTKDTVEVTVHVTPKPVPDKDKYDPTGGETTVPQGTPVSDKEITDLVKIPDGSKGVPTVVGDRPDTNV
PGDHKVTVDVTYPDGTKDTVEVTVHVTPKPVPDKDKYDPTGGETTVPQGTPVSDKEITDLVKIPDGSKGV
PTVVGDRPDTNVPGDHKVTVEVTYPDGTKDTVTVTIHVTPKPVPDKDKYDPTGGETTVPQGTPVSDKEIT
DLVKIPDGSKGVPTVVGDRPDTNVPGDHKVTVEVTYPDGTKDTVEVTVHVTPKPVPDKDKYDPTGGETTV
PQGTPVSDKEITDLVKIPDGSKGVPTVVGDRPDTNVPGDHKVTVEVTYPDGTKDTVTVTIHVTPKPVPDK
DKYDPTGGETTVPQGTPVSDKEITDLVKIPDGSKGVPTVVGDRPDTNVPGDHKVTVEVTYPDGTKDTVTV
TIHVTPKPDKDKYDPTGKAQQVNGKGNKLPATGENATPFFNVAALTIISSVGLLSVSKKKED

Molecule Role Protective antigen
Molecule Role Annotation (Pannaraj et al., 2008)
References