VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

bac

Gene Name bac
Sequence Strain (Species/Organism) Streptococcus agalactiae
NCBI Protein GI BAC98831
Other Database IDs CDD:273479
CDD:301352
CDD:214653
CDD:285864
CDD:293433
CDD:282865
CDD:283799
CDD:279132
Taxonomy ID 1311
Protein Name c protein beta antigen
Protein pI 7.31
Protein Weight 115168.35
Protein Length 1162
Protein Note Gram-positive signal peptide, YSIRK family; TIGR01168
Protein Sequence
>BAC98831.1 c protein beta antigen [Streptococcus agalactiae]
MFKSNYERKMRYSIRKFSVGVASVAVASLFMGSVAHASELVKDNSVKTTEVAAKPYPSMAQTDQGNNSSS
SELETTKMEIPTTDIKKAVEPVEKTAGETSATDTGKREKQLQQWKNNLKNDVDNTILSHEQKNEFKTKID
ETNDSDALLELENQFNETNRLLHIKQHEEVEKDKKAKQQKTLKQSDTKVDLSNIDKELNHQKSQVEKMAE
QKGITNEDKDSMLKKIEDIRKQAQQADKKEDAEVKVREELDKATTNEQATQVKNQFLENAQKLKEIQPLI
KETNVKLYKAMSESLEQVEKELKHNSEANLEDLVAKSKEIVREYEGKLNQSKNLPELKQLEEEAHSKLKQ
VVEDFRKKFKTSEQVTPKKRVKRDLAANENNQQKIELTVSPENITVYEGEDVKFTVTAKSDSKTTLDFSD
LLTKYNPSVSDRISTNYKTNTDNHKIAEITIKNLKLNESQTVTLKAKDDSGNVVEKTFTITVQKKEEKQV
PKTPEQKDSKTEEKVPQEPKSNDKNQLQELIKSAQQELEKLEKAIKELMEQPEIPSNPEYGIQKSIWESQ
KEPIQEAITSFKKIIGDSSSKYYTEHYFNKYKSDFMNYQLHAQMEMLTRKVVQYMNKYPDNAEIKKIFES
DMKRTKEDNYGSLENDALKGYFEKYFLTPFNKIKQIVDDLDKKVEQDQPAPIPENSEMDQAKEKAKIAVS
KYMSKVLDGVHQHLQKKNHSKIVDLFKELEAIKQQTIFDIDNAKTEVEIDNLVHDAFSKMNATVAKFQKG
LETNTPETPDTPKIPELPQAPDTPQAPDTPHVPESPKAPEAPRVPESPKTPEAPHVPESPKTPEAPKIPE
PPKTPDVPKLPDVPKLPDAPKLPDGLNKVGQAVFTSTDGNTKVTVVFDKPTDADKLHLKEVTTKELADKI
AHKTGGGTVRVFDLSLSKGGKETHVNGERTVRLALGQTGSDVHVYHVKENGDLERIPSKVENGQVVFKTN
HFSLFAIKTLSKDQNVTPPKQTKPSTQGSQVEIAESQTGKFQSKAANHKALATGNETVAKGNPTSTTEKK
LPYTGVASNLVLEIMGLLGLIGTSFIAMKRRKS

Molecule Role Protective antigen
Molecule Role Annotation (Yang et al., 2007)
References