VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

env

Gene Name env
Sequence Strain (Species/Organism) Bovine Leukemia virus
NCBI Protein GI BAV53924
Taxonomy ID 11901
Protein Name gp51
Protein pI 6.33
Protein Weight 17528.5
Protein Length 212
Protein Note genotype: 2
Protein Sequence
>BAV53924.1 gp51, partial [Bovine leukemia virus]
IYWPPPQGRRRFGARAMVTYDCEPRCPYVGADRFDCPHWDNASQADQGSFYVDHQILFLHLKQCHGIFTL
TWKIWGYDPLITFSLHKIPDPPQPDFPQLNSDWVPSVRSWALLLNQTARAFPDCAICWEPSPPWAPEILV
YNKTISSSGPGLALPDAQ

Molecule Role Protective antigen
Molecule Role Annotation (Kabeya et al., 1996)
References