VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Cov19VaxKB
Vaccine Mechanisms
VaximmutorDB
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign2
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

GP4

Gene Name GP4
Sequence Strain (Species/Organism) Porcine respiratory and reproductive syndrome virus
NCBI Protein GI ACV91353
Other Database IDs CDD:111400
Taxonomy ID 28344
Protein Name GP4
Protein pI 7.94
Protein Weight 18069.32
Protein Length 252
Protein Note Arterivirus glycoprotein; pfam02497
Protein Sequence
>ACV91353.1 GP4 [Porcine reproductive and respiratory syndrome virus]
MAAPFLFLLVGFKCFVVSQAFACKPCFSSSLSDIKTNTTAASGFVVLQDISCLRHGDSSSPTIRKSSQCR
TAIGTPVYITITANVTDENYLHSSDLLMLSSCLFYASEMSEKGFKVVFGNVSGIVAVCVNFTSYVQHVKE
FTQRSLVVDHVRLLHFMTPETMRWATVLACLFAILLAI

Molecule Role Protective antigen
Molecule Role Annotation (An et al., 2018)
References