VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

TA17050 merozoite-piroplasm surface antigen Tams1

Gene Name TA17050 merozoite-piroplasm surface antigen Tams1
Sequence Strain (Species/Organism) Theileria annulata
VO ID VO_0011188
NCBI Gene ID 3864438
NCBI Protein GI 84997996
Locus Tag TA17050
Genbank Accession AF214915
Protein Accession XP_953719
Taxonomy ID 5874
Chromosome No 1
Gene Starting Position 371414
Gene Ending Position 372259
Gene Strand (Orientation) -
Protein pI 9.46
Protein Weight 29651.5
Protein Length 281
DNA Sequence
>NW_001091929.1:371414-372259 Theileria annulata strain Ankara isolate clone C9 chromosome 1, *** SEQUENCING IN PROGRESS ***
TTTAAAGGAAGTAAAGGACTGATGAGAAGACGATGAGTACTGAGGCGAAGACTGCAAGGGGGGAGAACTT
GTCGACAACTGGTTTGTAATCGGTTGACCAGGATGAGTTCATGGCATTCAAGGCCTTGTTTGCATCTGCC
TGTGTCATTTGAACCCACTTATCGTCCTTAAGCTCGAAGTAGGTCTCCTTCAACCTTGAGTCACCGGTAT
AGAAGTAGTAGAGTTTGACGAACTTCTTGGAATCAGAACCAACAAAAACAACAACTTCAAGATACTTGGC
ATTGTTTGGTTTTCCGACTTCTTTCTTGTCGAAGGTGACTTTGGAAGGTTTAAATTCCTTTTTAAAGGTG
TACATCTTTCCAGTGCCGAAGGCGGAGGAGGTGAACAAAGATGTATCTTCGAACTTGGAAGCATCTAGTT
CCTTGGCGGATTTTCCCTTGAACAAGACATCATCGTAGTAGGTCTCGAATTTGACCTCAGAATATTCCTT
GTCTCCCTTCTTCTTGAACATCTTTGGCTGGGCAGGGTGAAGATTAAGTCTGAACCACTCATCGGATTCA
TGCTTAAGTTTGAATGCCTGTACTGGGGTATGTTTTGAGGTGTCAACATTGAACAAGGTCTTGTCTCCGA
CCTTAAGGGTCTTGAAACGGTAGCCATCCGCGACAGTTAACTCAGTGGTGTTAGAGTCGACGTTTTTAAA
GGTTACATTCTCACATGAAGTGAGAGTAACATCAAGAACAACATCTTTTTTTTCCTCCTTTTTCTTTTCA
TCCTCATTTGCAGCATTAACGGATGAGATAACGAAGAAGCTCAAATATAAGAACTTGAGGGTGGTCCTGG
ACAACA

Protein Sequence
>XP_953719.1 merozoite-piroplasm surface antigen Tams1 [Theileria annulata]
MLSRTTLKFLYLSFFVISSVNAANEDEKKKEEKKDVVLDVTLTSCENVTFKNVDSNTTELTVADGYRFKT
LKVGDKTLFNVDTSKHTPVQAFKLKHESDEWFRLNLHPAQPKMFKKKGDKEYSEVKFETYYDDVLFKGKS
AKELDASKFEDTSLFTSSAFGTGKMYTFKKEFKPSKVTFDKKEVGKPNNAKYLEVVVFVGSDSKKFVKLY
YFYTGDSRLKETYFELKDDKWVQMTQADANKALNAMNSSWSTDYKPVVDKFSPLAVFASVLIVFSSVLYF
L

Molecule Role Protective antigen
Molecule Role Annotation To test the potential of subunit vaccines against T. annulata infection, we immunized four groups of three calves with either recombinant (re-) (Tams1-1 and Tams1-2) proteins or naked DNA encoding these antigens. All calves vaccinated with ISCOMs proved to be protected from T. annulata infection and had generated antibodies against both re-(Tams1-1 and Tams1-2) at the time of challenge (d'Oliveira et al., 1997).
Related Vaccines(s) T. annulata Tams1 Protein Vaccine
References