VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

H3L

Gene Name H3L
Sequence Strain (Species/Organism) Vaccinia virus
VO ID VO_0010935
NCBI Gene ID 3707557
NCBI Protein GI 66275898
Locus Tag VACWR101
Genbank Accession KT184691
Protein Accession YP_232983
Taxonomy ID 10245
Gene Starting Position 88322
Gene Ending Position 89296
Gene Strand (Orientation) -
Protein Name IMV heparin binding surface protein
Protein pI 6.43
Protein Weight 34569.08
Protein Length 324
Protein Note similar to VACCP-H3L; involved in IMV maturation
DNA Sequence
>NC_006998.1:88322-89296 Vaccinia virus, complete genome
GTTAGATAAATGCGGTAACGAATGTTCCTGTAAGGAACCATAACAGTTTAGATTTAACGTTAAAGATGAG
CATAAACATAATAAACAAAATTACAATCAAACCTATAACATTAATATCAAACAATCCAAAAAATGAAATC
AGTGGAGTAGTAAACGCGTACATAACTCCTGGATAACGTTTAGTAGCTGCCGTTCCTATTCTAGACCAAA
AATTCGGTTTCATGTTTTCGAAACGGTGTTCTGCAACAAGTCGGGGATCGTGTTCTACATATTTGGCGGC
ATTATCCAGTATCTGCCTATTGATCTTCATTTCGTTTTCAATTCTGGCTATTTCAAAATAAAATCCCGAT
GATAGACCTCCAGACTTTATAATTTCATCTACGATGTTCAGCGCCGTAGTAACTCTAATAATATAGGCTG
ATAAGCTAACATCATACCCTCCTGTATATGTGAATATGGCATGATTTTTGTCCATTACAAGCTCGGTTTT
AACTTTATTGCCTGTAATAATTTCTCTCATCTGTAGGATATCTATTTTTTTGTCATGCATTGCCTTCAAG
ACGGGACGAAGAAACGTAATATCCTCAATAACGTTATCGTTTTCTACAATAACTACATATTCTACCTTTT
TATTTTCTAACTCGGTAAAAAAATTAGAATCCCATAGGGCTAAATGTCTAGCGATATTTCTTTTCGTTTC
CTCTGTACACATAGTGTTACAAAACCCTGAAAAGAAGTGAGTATACTTGTCATCATTTCTAATGTTTCCT
CCAGTCCACTGTATAAACGCATAATCCTTGTAATGATCTGGATCATCCTTGACTACCACAACATTTCTTT
TTTCTGGCATAACTTCGTTGTCCTTTACATCATCGAACTTCTGATCATTAATATGCTCATGAACATTAGG
AAATGTTTCTGATGGAAGTCTATCAATAACTGGCACAACAATAACAGGAGTTTTCGCCGCCGCCA

Protein Sequence
>YP_232983.1 IMV heparin binding surface protein [Vaccinia virus]
MAAAKTPVIVVPVIDRLPSETFPNVHEHINDQKFDDVKDNEVMPEKRNVVVVKDDPDHYKDYAFIQWTGG
NIRNDDKYTHFFSGFCNTMCTEETKRNIARHLALWDSNFFTELENKKVEYVVIVENDNVIEDITFLRPVL
KAMHDKKIDILQMREIITGNKVKTELVMDKNHAIFTYTGGYDVSLSAYIIRVTTALNIVDEIIKSGGLSS
GFYFEIARIENEMKINRQILDNAAKYVEHDPRLVAEHRFENMKPNFWSRIGTAATKRYPGVMYAFTTPLI
SFFGLFDINVIGLIVILFIMFMLIFNVKSKLLWFLTGTFVTAFI

Molecule Role Protective antigen
Molecule Role Annotation Mice were immunized with recombinant H3L protein to examine H3L-specific antibody responses in greater detail. H3L-immunized mice developed high-titer vaccinia virus-neutralizing antibodies (mean PRNT50 = 1:3,760). Importantly, H3L-immunized mice were subsequently protected against lethal intranasal challenges with 1 or 5 50% lethal doses (LD50) of pathogenic vaccinia virus strain WR, demonstrating the in vivo value of an anti-H3L response. To formally demonstrate that neutralizing anti-H3L antibodies are protective in vivo, we performed anti-H3L serum passive-transfer experiments. Mice receiving H3L-neutralizing antiserum were protected from a lethal challenge with 3 LD50 of vaccinia virus strain WR (5/10 versus 0/10; P < 0.02) (Davies et al., 2005).
Related Vaccines(s) IMV-EEV
References