VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

SAG1

Gene Name SAG1
Sequence Strain (Species/Organism) Sarcocystis neurona 3106
VO ID VO_0011253
NCBI Protein GI 295682690
Other Database IDs CDD:252367
Taxonomy ID 42890
Gene Strand (Orientation) ?
Protein Name surface antigen 1
Protein pI 7.22
Protein Weight 26504.924
Protein Length 333
Protein Note SRS domain; pfam04092
Protein Sequence
>ADG26774.1 surface antigen 1 [Sarcocystis neurona]
MTRAVLLTFLTLCSARVSLVRAGAPPQATCANGETTVTKLGSSGALRIHCPNNFRLAPRAGNDAGQMQVY
ATAVAENPVNIRDVLPGASYLSVQNVPTLTVPQLPAKATSVFFHCQQQPDNQCFIQVEVAPAPRLGPNTC
AALQSTIAFEVQQANETAVFSCGEGLAVFPQGSKALDEACSKEQALPSGAALAPKDGGLHLGFPQLPQQA
MKICYICTNGGVQAEAAQRCEVRISVAANPDGSVPGANGAASXGAAARSAXALGLALVAGAFLHFC

Molecule Role Protective antigen
Molecule Role Annotation Horses were vaccinated with adjuvanted recombinant SnSAG1 (rSnSAG1)and 5 control (sham vaccinated) horses were vaccinated with adjuvant only. The effect of vaccination with rSnSAG1 on in vivo infection by S. neurona was evaluated by challenging all the horses with S. neurona merozoites. The study showed that vaccination with rSnSAG-1 produced antibodies in horses that neutralized merozoites when tested by in vitro culture and significantly reduced clinical signs demonstrated by in vivo challenge (Ellison and Witonsky, 2009).
Related Vaccines(s) S. neurona SAG1 Protein Vaccine
References