VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

PhoP

Gene Name PhoP
Sequence Strain (Species/Organism) Salmonella enterica subsp. enterica serovar Typhi str. Ty2
NCBI Gene ID 1071307
NCBI Protein GI 29142123
Locus Tag t1689
Genbank Accession AE014613
Protein Accession NP_805465
Taxonomy ID 209261
Gene Starting Position 1752334
Gene Ending Position 1753008
Gene Strand (Orientation) +
Protein Name DNA-binding transcriptional regulator PhoP
Protein pI 5.16
Protein Weight 23440.94
Protein Length 224
Protein Note response regulator in two-component regulatory system with PhoQ; involved in magnesium starvation and stress
DNA Sequence
>gi|29140543:1752334-1753008 Salmonella enterica subsp. enterica serovar Typhi str. Ty2, complete genome
GATGATGCGCGTACTGGTTGTAGAGGATAATGCATTATTACGCCACCACCTGAAGGTTCAGCTCCAGGAT
TCAGGTCACCAGGTCGATGCCGCAGAAGATGCCAGGGAAGCTGATTACTACCTTAATGAACACCTTCCGG
ATATCGCTATTGTCGATTTAGGTCTGCCGGATGAAGACGGCCTTTCCTTAATACGCCGCTGGCGCAGCAG
TGATGTTTCACTGCCGGTTCTGGTGTTAACCGCGCGCGAAGGCTGGCAGGATAAAGTCGAGGTTCTCAGC
TCCGGGGCCGATGACTACGTGACGAAGCCATTCCACATCGAAGAGGTAATGGCGCGTATGCAGGCGTTAA
TGCGCCGTAATAGCGGTCTGGCCTCCCAGGTGATCAACATCTCGCCTTTCCAGGTGGATCTCTCACGCCG
GGAATTATCCGTCAATGAAGAGGTCATCAAACTCACGGCGTTCGAATACACCATTATGGAAACGCTTATC
CGTAACAACGGTAAAGTGGTCAGCAAAGATTCTCTGATGCTTCAGCTGTATCCGGATGCGGAACTGCGGG
AAAGTCATACCATTGATGTTCTCATGGGGCGTCTGCGGAAAAAAATACAGGCCCAGTATCCGCACGATGT
CATTACCACCGTACGCGGACAAGGATATCTTTTTGAATTGCGCTA
Protein Sequence
>gi|29142123|ref|NP_805465.1| DNA-binding transcriptional regulator PhoP [Salmonella enterica subsp. enterica serovar Typhi str. Ty2]
MMRVLVVEDNALLRHHLKVQLQDSGHQVDAAEDAREADYYLNEHLPDIAIVDLGLPDEDGLSLIRRWRSS
DVSLPVLVLTAREGWQDKVEVLSSGADDYVTKPFHIEEVMARMQALMRRNSGLASQVINISPFQVDLSRR
ELSVNEEVIKLTAFEYTIMETLIRNNGKVVSKDSLMLQLYPDAELRESHTIDVLMGRLRKKIQAQYPHDV
ITTVRGQGYLFELR
Molecule Role Virmugen
Molecule Role Annotation Three S. typhi deletion mutants (phoP, rpoS, and rpoS-phoP double mutant) were constructed and characterized with respect to invasiveness, virulence, and protective immune response compared with wild-type Ty2. All S. typhi mutants showed an increase in the specific serum IgG levels and T-cell-mediated immunity, and showed equal protection abilities against a wild-type Ty2 challenge after two rounds of immunization in BALB/c mice (Lee et al., 2007).
Related Vaccines(s) Salmonella Typhi phoP mutant vaccine
References