VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

CEL-170/4

Gene Name CEL-170/4
Sequence Strain (Species/Organism) Entamoeba histolytica
VO ID VO_0011326
NCBI Protein GI 401088
Taxonomy ID 5759
Gene Strand (Orientation) ?
Protein Name 170 kDa surface lectin
Protein pI 4.96
Protein Weight 138236.38
Protein Length 1384
Protein Note {ECO:0000269|PubMed:2000392, ECO:0000269|PubMed:2536731}.
Protein Sequence
>sp|P23502.2|SL17_ENTHI RecName: Full=170 kDa surface lectin; Flags: Precursor
MKLLLLNILLLCCLADKLNEFSADIDYYDLGIMSRGKNAGSWYHSYTHQYDVFYYLAMQPWRHFVWTTCE
TTKGNKECYKYIINEDHNLNAQQLNNIKNLDKQDFCQKEYAYPIEKYEVDWDNVPVDEQQIESVDINGKT
CFKYAAKRPLAYVYLNTKMTYATKTEAYDVCRMDFIGGRSITFRSFNNENKDFIDQYNTNTTSKCIIDVH
KNNVNTHLAIILGITDSTVIKSLQENLSLLSQLKQSRVTLYYLKDDSYATDNIKLKDLKYETLVKYTAGQ
GQVDPLVNQAKNDLFKMISDKKIKRGTMVVLMDNALGSEFNAETEFDRKNISVHTVVLNRNKDSKITYSA
LKLVSLGPHYHEFTSNSEVSTTIDELFKGIRANLTERCDRDKCSGFCDAMNRCTCPMCCENDCFYTSCDV
ETGSCIPWPKAKPKAKKECPATCVGLYECKDLEGCVVTKYNASCEPKVKCMVPYCDDDNNLKEVCKQKAN
CEADQKPSSDGYCWSYTCDETTGFCKKYKHGNLCTGKTTNCQEYVCDSEQRCTVQEKVCVKTSPYIEMSC
YVAKCNLNTGMCENRLSCDTYSSCGGDSTGSVCKCDASTGNQCKCNKVENGNYCDSSKHEICDYTGDKPK
CIVSECTEDLVRDGCLIKRCNKTSKTTYWENVDCSNTKIEFAQDGKSETMCKPYYSATCLNGQCVVQAVG
DVSNVGCGYCSMGTDNVITYHDDCDSRKSQCGNFNGKCQPNGDNSYSCVFEKDKTSSKSDNDICAECSSL
TCPADTTYRTYTYDSKTGTCKATVKPTPSCSVCEKGKFVEKSKDQKLERKVTLEDGKEYQYNIPKDCVNE
QCIPRTYVDCLANDDNFGEIYKFYLPCQAYVTATYHYSSLFNLTSYKLHLPQSEEFMKEADKEAYCTYEI
TTRECKTCSLTETKEKVEEIDLCAEETKNGGVPFKCKNNNCIIDPNFDCQPIECKIQEIVITEKDGIKTT
TCKDGTKTTCDTNNKRIEDARKAFIEGKEGIEQVECASTVCQNDNSCPIIADVEKCNQNTEVDYGCKAMT
GECDGTTYLCKFVQLTDDPSLDSEHFRTKSGVELNNACLKYKCVESKGSDGKITHKWEIDTERSNIDPKP
RNPCETATCDQTTGETIYTKKTCTVSEEFPTITPNQGRCFYCQCSYLDGSSVLTMYGETDKEYYDLDACG
NCRVWNQTDRTQQLNNHTECILAGEINNVGAIAAATTVAVVVVAVVVALIVVSIGLFKTYQLVSSAMKNA
ITTTNENAEYVGADNEATNAATYNG

Molecule Role Protective antigen
Molecule Role Annotation Researcherse tested the ability of the galactose-specific adherence lectin of E. histolytica to elicit a protective immune response in conjunction with Freund's incomplete and complete adjuvants. Four independent trials demonstrated complete protection from amebic liver abscess formation in 67% of lectin-immunized gerbils. The gerbil antilectin antibodies were shown by Western immunoblotting to be directed to the heavy subunit (CEL-170/4) but not the light subunit of the lectin (Petri and Ravdin, 1991).
Related Vaccines(s) E. histolytica CEL-170/4 protein vaccine
References