VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

sar5

Gene Name sar5
Sequence Strain (Species/Organism) Streptococcus agalactiae Compton R
VO ID VO_0012393
NCBI Protein GI 5327234
Other Database IDs CDD:273479
CDD:283989
CDD:273478
GOA:Q9XAS7
InterPro: IPR001899
InterPro: IPR005877
UniProtKB/TrEMBL: Q9XAS7
Taxonomy ID 1311
Gene Strand (Orientation) ?
Protein Name BPS protein
Protein pI 4.92
Protein Weight 96916.55
Protein Length 1045
Protein Note Gram-positive signal peptide, YSIRK family; TIGR01168
Protein Sequence
>CAB46338.1 BPS protein [Streptococcus agalactiae]
MFRQYNFEKGLNFSIRKFSVGIASVAIGSLLFILPQVLADETTSVTSATTPTGVTTTDANLVNPNNSTPT
STNRSATSTQGSNLSNTSEIIKPATLAATSPTTDNVAPSVDKRTYATSGDWTLQNPYADSVRNKNISPSV
RHESFKSAETTVVRHDNSTVKVTATITPVEGNDEGSGILTNGGNQSEYKATSEMFVGNVDPAKIPALGVY
TQPGRTEGGSKLSDKLNFNGKAPSTILTLKFDKAVTDPIIDLSGVGGNARLSFTETVMENGKIVEKFDYA
RGSYNSTFFDGITPGISLEKASSGVNLTVTANTVDVTDKNTFNESVVNPSDEDFVNGPDRTPDAVPAGTG
SIRLKGTFTDASFKLYHQAVPSTAFSKEKYHTGDGYYNSIANVRPTVVKPDSINGLNKHASDVIDYKISD
NNDISNDDLLRLSVRLQNPRGSVVVNYIDTEGNIIGTEYKDTTDAIPGTHYNTAESSGDLNSDATVERPS
TITKDGKVYDLVAENITVPVGKVNSDGTLATNGSSFNYGTDAASAEVAEGTKSVIYVISIKQESKGNVHA
RYVILGTETELASAKTVKSEAPIDEAYSDKAPATLEKDGKLYEFVHVRDNKGDAPADGKVTEQDQTITYE
YVEVPKGRVVVDYVIEGTATKPKDTYVDTPTAYIRDKEGQAIPYNTAENDSEKPLLLDKDGIKYELVSIQ
EGSAAEKGTLREGEQHVVYQYRKVVEVPSVKVGNVHARYVILGTETELASAKTVKSEAPIDEAYSDKAPA
TLEKDGKLYEFVHVRDNKGDAPADGKVTEQDQTITYEYKLKKDDADAVGNVVINYVDETGNVIKKPILDT
HESKVGTPYDTTDYKFAEIKFNGKIYKLVSAKTMGNEFGKVTEGTTEVTYVYRESVKSTLPKETGISIPS
ESESPKFISTQTTENRPNKGVLTSSKNPTNKSVLPTTGEESNRILGVVGITLVATTATLAASSLKRRKN

Molecule Role Protective antigen
Molecule Role Annotation Immunization of mice with recombinant BPS protein by the subcutaneous route produced an efficient antigen-specific response, and immunized animals survived challenge with a lethal dose of a virulent strain (Erdogan et al., 2002).
Related Vaccines(s) S. agalactiae BPS Protein Vaccine
References