VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

SfbI

Gene Name SfbI
Sequence Strain (Species/Organism) Streptococcus pyogenes DSM 2071
VO ID VO_0012394
NCBI Nucleotide GI 511149
NCBI Protein GI WP_014407228
Protein Accession CAA48133.1
Other Database IDs CDD:311998
CDD:331285
CDD:308566
Taxonomy ID 1314
Gene Strand (Orientation) ?
Protein Name fibronectin-binding protein SfbI
Protein pI 4.15
Protein Weight 64222.46
Protein Length 694
Protein Note Thioester domain; pfam08341
DNA Sequence
>gi|511149|emb|X67947.1| S.pyogenes Sfb gene for fibronectin-binding protein (partial)
TAAAGCAATATTTTCTCAAAAAATCATTTTCAAAAACATTAATTTGGTGAAAAATATAATCAAAAAATTG
TCTTTCTTGACAATAACGTGGTAAGCTCATATATGTTTGTGAGAGGAGAGAAAATGAATAACAAAATGTT
TTTGAACAAAGAAGCCGGTTTTTTGGCACACACAAAAAGAAAAAGGCGATTTGCTGTCACTTTAGTGGGA
GTCTTTTTTATGCTTTTGGCATCCGCGGGTGCTATCGGTTTTGGTCAAGTAGCCTATGCTGCCGATGAGA
AGACTGTGCCTCATAGAGTTAGTCAAAATCCTGAGTTTCCCTGGTATGGTTATGATTTCTACAAAGGACC
TTACACAAGATATCATAATTTACAGCTAAATCTCAACGGAAGTAAAACATATCAGGCTTATTGTTTTAAT
TTAAAGAGATTTGAACCTAAGAAAGAAGGTAGTTATTTTCCGAATTGGTATAAGAGGTGGGATGGTAGTG
AAGAGACATTTGTAAAATATGCTGATAACCCCAGAAAAGATAATGAAAGTTCCAGAGTTATAGATGTAGA
ATTAGAAAAAAATATATTAAGAGTGCTATATAATGGATATCCGAATAACGGTAATGGAATCATGGAGGGT
TTAGAACCATTAAATGCTATCTTAGTAACTCAAAATGCTGTTTGGTACTATTCTGATAATTCATCTATTT
TTAATACTGATAACTTCTTTACGACTGAAGCTAAAGATCTTAATATAAAACCTGAGCAATTATCATTAAT
GCGTGTTGCATTAAAGAAATTGATAGATCCTAAGTTATCTGAAGAATCATTGAAACCTGTGCCATCTACT
TTTAGACTGAATATTTTCGAATCTCAGGATAAGCTATATCAAAATCTTCTAAGTGCTGAGTTTGTACCAG
AAAATCCCCCTAAACCTGGTGAAACCCCTGAACATGGACCCAAAACTCCCGAGTTGGATGGCACTCCAAT
TCCCGAAGGCCCACAACGTCCAAATGAGAGTTTAGAACCTACGCTTCCACCAGTGATGCTAGACGGACAA
GAAGTCCCCGAAGTTCCAAGTGAGAGCTTAGAACCTGCGCTTCCCCCATTGATGCCAGAGCTAGATGGCC
AAGAAGTCCCAGAAGTTCCAAGCGAGAGCTTAGAACCTGCGCTTCCCCCATTGATGCCAGAGTTAGATGG
TCAAGAAGTCCCTGAAAAACCTAGTGTTGACTTACCTATTGAAGATCCTCGTTATGAGTTTAACAATAAA
GACCAATCACCTCTAGCGGGTGAGTCTGGTGAGACGGAGTATATTACCGAAGTTTATGGAAATCAACAGA
ACCCTGTTGATATTGATAAAAAACTTCCGAATGAAACAGGTTTTTCAGGAAATATGGTTGAGACAGAAGA
TACGAAAGAGCCAGGAGTGTTGATGGGAGGTCAAAGTGAGTCTGTTGAATTTACTAAAGACACTCAAACA
GGCATGAGTGGTCAAACAACTCCTCAGGTTGAGACAGAAGACACGAAAGAGCCAGGAGTGCTGATGGGAG
GTCAAAGTGAGTCTGTTGAATTTACCAAAGATACTCAAACAGGCATGAGTGGTCAAACAGCTTCTCAGGT
TGAGACAGAAGATACGAAAGAGCCAGGAGTGCTGATGGGAGGCCAAAGTGAGTCTGTTGAATTTACTAAA
GACACTCAAACAGGCATGAGTGGTCAAACAACTCCTCAGGTTGAGACAGAAGACACGAAAGAGCCAGGAG
TATTGATGGGAGGTCAAAGTGAATCTGTTGAATTTACTAAAGACACTCAAACAGGCATGAGCGGTTTCAG
TGAAACAGTGACCATTGTTGAAGATACCCGTCCGAAGTTAGTGTTCCATTTTGACAATAATGAGCCCAAA
GTGGAAGAGAATCGGGAAAAGCCTACAAAAAATATAACACCTATCCTTCCTGCAACAGGAGATATTGAGA
ATGTTTTGGCCTTTCTTGGAATCCTTATTTTGTCAGTACTTCCTATTTTTAGTCTTTTAAAAAAACAAAC
AAAACAATAAAGTCTGATCGTAAAAGTGTTCCATAAGAAATAATGCGCAAATATGCTGAATAGTGGATAA
CTGCTACAGTCAAGACAAGTGTTAATTCAAAAGGTACTACTTATACATCTGATAATAATAAGGTGACAGA
TAATTCAGAGCAAGTAGGATGGCTAAAAAATGGTGTATTCTATGTATAATAGACTACATAGAAATCAAGT
TATTGTTAAACGTCGTAAAGCTT
Protein Sequence
>WP_014407228.1 fibronectin-binding protein SfbI [Streptococcus pyogenes]
MNNKIFLNKEAGFLAHTKRKRRFAVTLVGVFFMLLACAGAIGFGQVAYAADERTVPNHSSTNPEFPWYGY
DSYRGIFARYHNLKVNLKGSKEYQAYCFNLTKYFPRPTYSTTNNFYKKIDGSGSAFKSYAANPRVLDENL
DKLEKNILNVIYNGYKSNANGFMNGIEDLNAILVTQNAIWYYSDSAPLNDVNKMWEREVRNGEISESQVT
LMREALKKLIDPNLEATAVNKIPSGYRLNIFKSENEDYQNLLSAEYVPDDPPKPGDTSEHNPKTPELDGS
PIPEDPKHPDDNLEPTLPPVMLDGEEVPEVPSESLEPALPPLMPELDGEEVPEVPSESLEPALPPLMPEL
DGEEVPEVPSESLEPALPSLMPELDGEEVPEVPSESLEPAFPPLMPELDGQEVPEKPSVDLPIEVPRYEF
NNKDQSPLAGESGETEYITEVYGNQQNPVDIDKKLPNETGFSGNMVETEDTKEPEVLMGGQSESVEFTKD
TQTGMSGQTTPQVETEDTKEPGVLMGGQSESVEFTKDTQTGMSGFSETVTIVEDTRPKLVFHFDNNEPKV
EENREKPTKNIAPILPATGDIGNVLAFLGILILSVLSIFSLLKNKQNNKV
Molecule Role Protective antigen
Molecule Role Annotation Intranasal immunization of mice with either SfbI alone or coupled to cholera toxin B subunit (CTB) triggered efficient SfbI-specific humoral (mainly IgG) and lung mucosal (14% of total IgA) responses. SfbI-vaccinated animals showed 80% and 90% protection against homologous and heterologous challenge, respectively (Guzmán et al., 1999).
Peptides incorporated in the Lipid-Core Peptide (LCP) vaccine delivery system derived from the important streptococcal virulence factors M protein and the fibronectin-binding protein SfbI. The present work clearly demonstrates the potential of these synthetic dual antigen multi-epitope mucosal GAS prophylactic vaccines as an approach to deliver vaccine antigens and adjuvants across mucosal membranes resulting in the stimulation of protective immune responses.(Schulze et al., 2017)
Related Vaccines(s) S. pyogenes SfbI Protein Vaccine
References