VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

fbaA

Gene Name fbaA
Sequence Strain (Species/Organism) Streptococcus pyogenes SSI-9
VO ID VO_0012396
NCBI Protein GI 14915682
Other Database IDs CDD:273479
CDD:320995
CDD:273478
Taxonomy ID 1314
Gene Strand (Orientation) ?
Protein Name fibronectin-binding protein
Protein pI 4.73
Protein Weight 36233.27
Protein Length 427
Protein Note Gram-positive signal peptide, YSIRK family; TIGR01168
Protein Sequence
>BAB62098.1 fibronectin-binding protein [Streptococcus pyogenes]
MRRAENNKHSRYSIRKLSVGVTSIAIASLFLGKVAYAVDGIPPISLTQKTTATTSENWHHIDKDGLIPLG
ISLEAAKEEFKKEVEESRLSEAQKETYKQKIKTAPDKDKLLFTYHSEYMTAVKDLPASTESTTQPVEAPV
QETQASASDSMVTGDSTSVTTDSPEETPSSESPVAPALSEAPAQPAESEEPSVAASSEETPSPSTPAAPS
TPAAPETPEEPAAPSQPAESEESSVAATTSPSPSTPAESETQTPPAVTKDSDKPSSAAEKPAASSLVSEQ
TVQQPTSKRSSDKKEEQEQSYSPNRSLSRQVRAHESGKYLPSTGEKAQPLFIATMTLMSLFGSLLVTKRQ
KETKK

Molecule Role Protective antigen
Molecule Role Annotation Mice immunized with FbpA were protected from challenge with group A streptococcus (Ma et al., 2009).
Related Vaccines(s) S. pyogenes FbaA Protein Vaccine
References