VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

emm1

Gene Name emm1
Sequence Strain (Species/Organism) Streptococcus pyogenes
VO ID VO_0012397
NCBI Nucleotide GI 311757
NCBI Protein GI 311758
Protein Accession CAA44062.1
3D structure: PDB ID 2OTO
Other Database IDs CDD:273479
CDD:291694
CDD:295219
CDD:279132
GOA:Q10372
HSSP: 1IC2
InterPro: IPR001899
InterPro: IPR005877
InterPro: IPR019931
InterPro: IPR019948
InterPro: IPR019950
UniProtKB/TrEMBL: Q10372
Taxonomy ID 1314
Gene Strand (Orientation) ?
Protein Name M protein type 1
Protein pI 6.86
Protein Weight 52910.57
Protein Length 546
Protein Note Gram-positive signal peptide, YSIRK family; TIGR01168
DNA Sequence
>gi|311757|emb|X62131.1| S.pyogenes emm1 (29/58) gene for M protein type 1
GGATCCAATGATAACATAAGGAGCATAAAAATGGCTAAAAATAACACGAATAGACACTATTCGCTTAGAA
AATTAAAAACAGGAACGGCTTCAGTAGCGGTAGCTTTGACTGTTTTAGGGGCAGGTTTTGCGAATCAAAC
AGAGGTTAAGGCTAACGGTGATGGTAATCCTAGGGAAGTTATAGAAGATCTTGCAGCAAACAATCCCGCA
ATACAAAATATACGTTTACGTCACGAAAACAAGGACTTAAAAGCGAGATTAGAGAATGCAATGGAAGTTG
CAGGAAGAGATTTTAAGAGAGCTGAAGAACTTGAAAAAGCAAAACAAGCCTTAGAAGACCAGCGTAAAGA
TTTAGAAACTAAATTAAAAGAACTACAACAAGACTATGACTTAGCAAAGGAATCAACAAGTTGGGATAGA
CAAAGACTTGAAAAAGAGTTAGAAGAGAAAAAGGAAGCTCTTGAATTAGCGATAGACCAGGCAAGTCGGG
ACTACCATAGAGCTACCGCTTTAGAAAAAGAGTTAGAAGAGAAAAAGAAAGCTCTTGAATTAGCGATAGA
CCAAGCGAGTCAGGACTATAATAGAGCTAACGTCTTAGAAAAAGAGTTAGATACGATTACTAGAGAACAA
GAGATTAATCGTAATCTTTTAGGCAATCGAAAACTTGAACTTGATCAACTTTCATCTGAAAAAGAGCAGC
TAACGATCGAAAAAGCAAAACTTGAGGAAGAAAAACAAATCTCAGACGCAAGTCGTCAAAGCCTTCGTCG
TGACTTGGACGCATCACGTGAAGCTAAGAAACAGGTTGAAAAAGATTTAGCAAACTTGACTGCTGAACTT
GATAAGGTTAAAGAAGACAAACAAATCTCAGACGCAAGCCGTCAAGGCCTTCGCCGTGACTTGGACGCAT
CACGTGAAGCTAAGAAACAGGTTGAAAAAGATTTAGCAAACTTGACTGCTGAACTTGATAAGGTTAAAGA
AGAAAAACAAATCTCAGACGCAAGCCGTCAAGGCCTTCGCCGTGACTTGGACGCATCACGTGAAGCTAAG
AAACAAGTTGAAAAAGCTTTAGAAGAAGCAAACAGCAAATTAGCTGCTCTTGAAAAACTTAACAAAGAGC
TTGAAGAAAGCAAGAAATTAACAGAAAAAGAAAAAGCTGAACTACAAGCAAAACTTGAAGCAGAAGCAAA
TGTACTTAAAGATCCATTAGCGAAACAAGCTGAAGAACTCGCAAAACTAAGAGCTGGAAAAGCATCAGAC
TCACAAACCCCTGATACAAAACCAGGAAACAAAGCTGTTCCAGGTAAAGGTCAAGCACCACAAGCAGGTA
CAAAACCTAACCAAAACAAAGCACCAATGAAGGAAACTAAGAGACAGTTACCATCAACAGGTGAAACAGC
TAACCCATTCTTCACAGCGGCAGCCCTTACTGTTATGGCAACAGCTGGAGTAGCAGCAGTTGTAAAACGC
AAAGAAGAAAACTAAGCTGAATTC
Protein Sequence
>CAA44062.1 M protein type 1 [Streptococcus pyogenes]
MAKNNTNRHYSLRKLKTGTASVAVALTVLGAGFANQTEVKANGDGNPREVIEDLAANNPAIQNIRLRHEN
KDLKARLENAMEVAGRDFKRAEELEKAKQALEDQRKDLETKLKELQQDYDLAKESTSWDRQRLEKELEEK
KEALELAIDQASRDYHRATALEKELEEKKKALELAIDQASQDYNRANVLEKELDTITREQEINRNLLGNR
KLELDQLSSEKEQLTIEKAKLEEEKQISDASRQSLRRDLDASREAKKQVEKDLANLTAELDKVKEDKQIS
DASRQGLRRDLDASREAKKQVEKDLANLTAELDKVKEEKQISDASRQGLRRDLDASREAKKQVEKALEEA
NSKLAALEKLNKELEESKKLTEKEKAELQAKLEAEANVLKDPLAKQAEELAKLRAGKASDSQTPDTKPGN
KAVPGKGQAPQAGTKPNQNKAPMKETKRQLPSTGETANPFFTAAALTVMATAGVAAVVKRKEEN

Molecule Role Protective antigen
Molecule Role Annotation Mice were intranasally immunized with diphtheria toxoid (DT) conjugated polypeptides encompassing a conformational-constrained B cell epitope of the M1 protein (J8). Vaccinated mice were challenged 10 days after the last boost by the intranasal route. Animals had 60% protection against challenge (Schulze et al., 2006).
Related Vaccines(s) S. pyogenes M Protein Vaccine
References