VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

sib35

Gene Name sib35
Sequence Strain (Species/Organism) Streptococcus pyogenes serotype M12
VO ID VO_0012398
NCBI Protein GI 90567992
Other Database IDs CDD:286161
Taxonomy ID 342023
Gene Strand (Orientation) ?
Protein Name immunoglobulin-binding protein 35
Protein pI 7.68
Protein Weight 36275.97
Protein Length 431
Protein Note Mac 1; pfam09028
Protein Sequence
>BAE92207.1 immunoglobulin-binding protein 35 [Streptococcus pyogenes serotype M12]
MRKRCYSTSAAVLAAVTLFVLSVDRGVIADSFSANQEIRYSEVTPYHVTSVWTKGVTPPAKFTQGEDVFH
APYVAKQGWYDITKTFNGKDDLLCGAATAGNMLHWWFDQNNEKIEAYLKKHPDKQKIMFGDQELLDVRKV
INTKGDQTNSELFNYFRDKAFPGLSARRIGVMPDLVLDMFINGYYLNVYKTQTTDVNRTYQEKDRRGGIF
DAVFTRGDQSKLLTSRHDFKEKTLKEISDLIKKELTEGKALGLSHTYANVRINHVINLWGADFDSNGNLE
AIYVTDSDSNASIGMKKYFVGVNSAGKVAISAKEIKEDNIGAQVLGLFTLSTGQDSWNQTN

Molecule Role Protective antigen
Molecule Role Annotation Immunization with Sib 35 enhanced survival rates in mice challenged with a GAS strain, while exhibiting no toxicity in hosts (Okamoto et al., 2005).
Related Vaccines(s) S. pyogenes Sib35 Protein Vaccine
References