VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

GlpQ

Gene Name GlpQ
Sequence Strain (Species/Organism) Treponema pallidum subsp. pallidum str. Nichols
VO ID VO_0012399
NCBI Gene ID 2611763
NCBI Protein GI 499184166
Locus Tag TP_RS01315
Genbank Accession AE000520
Protein Accession WP_010881706
Taxonomy ID 243276
Gene Starting Position 268189
Gene Ending Position 269259
Gene Strand (Orientation) +
Protein Name glycerophosphoryl diester phosphodiesterase
Protein pI 9.44
Protein Weight 38335.23
Protein Length 356
Protein Note hydrolyzes deacylated phospholipids to glycerol 3-phosphate and the corresponding alcohols; periplasmic
DNA Sequence
>NC_000919.1:268189-269259 Treponema pallidum subsp. pallidum str. Nichols complete genome
TATGCGGGGAACATATTGTGTGACGCTTTGGGGGGGGGTGTTTGCGGCATTGGTTGCAGGCTGTGCGTCC
GAACGTATGATAGTTGCGTATCGGGGCGCTGCAGGATATGTGCCCGAGCACACCTTTGCCTCGAAAGTTC
TTGCTTTTGCACAAGGAGCAGATTACCTGCAGCAGGATGTCGTGCTTTCAAAGGATAATCAGCTTATCGT
AGCGCAAAGCCATATTCTGGATAATATGACTGACGTGGCAGAAAAATTTCCACGCCGGCAGCGTGCGGAT
GGGCATTTCTATGTCATAGATTTTACGGTAGAAGAACTTTCCCTCCTCCGTGCAACCAATAGTTTCTATA
CGCGCGGTAAGCGACATACGCCGGTGTATGGCCAGCGCTTTCCTCTTTGGAAGCCTGGTTTTAGGCTGCA
CACTTTTGAAGAGGAGTTGCAGTTTATCCGTGGGTTGGAACAGACAACCGGGAAAAAGATTGGAATTTAC
TCTGAAATAAAGGTGCCGTGGTTTCATCATCAGGAAGGAAAAGACATCGCAGCGCTTACCCTCGCTCTGT
TGAAAAAATACGGTTACCAAAGTCGATCGGATCTAGTGTATGTGCAAACGTATGATTTTAACGAGCTGAA
GCGTATCAAACGAGAACTTTTACCAAAGTACGAAATGAACGTGAAGCTGATTCAGCGTGTTGCTTACACA
GATCAACGTGAAACACAGGAGAAGGACTCGCGTGGGAAATGGATAAACTACAATTACAATTGGATGTTTG
AGCCCGGTGGTATGCAGAAAATAGCAAAATATGCAGACGGCGTGGGTCCTGACTGGAGGATGCTCATAGA
GAATGAATGGTCGAAGGTGGGCGCTGTTCGCCTGAGTCCGATGGTTTCTGCAATCCAAGATGCGAAATTG
GAATGTCATGTGCACACGGTACGGAAAGAAACACTGCCTAGCTACGCGCGCACCATGGACGAGATGTTTT
CCATTTTGTTCAAACAGACGGGCGCAAACGTGGTGCTCACGGATTTTCCTGATCTTGGGGTAAAGTTTCT
GGGCAAACCCGCCCGCTATTG

Protein Sequence
>WP_010881706.1 glycerophosphodiester phosphodiesterase [Treponema pallidum]
MRGTYCVTLWGGVFAALVAGCASERMIVAYRGAAGYVPEHTFASKVLAFAQGADYLQQDVVLSKDNQLIV
AQSHILDNMTDVAEKFPRRQRADGHFYVIDFTVEELSLLRATNSFYTRGKRHTPVYGQRFPLWKPGFRLH
TFEEELQFIRGLEQTTGKKIGIYSEIKVPWFHHQEGKDIAALTLALLKKYGYQSRSDLVYVQTYDFNELK
RIKRELLPKYEMNVKLIQRVAYTDQRETQEKDSRGKWINYNYNWMFEPGGMQKIAKYADGVGPDWRMLIE
NEWSKVGAVRLSPMVSAIQDAKLECHVHTVRKETLPSYARTMDEMFSILFKQTGANVVLTDFPDLGVKFL
GKPARY

Molecule Role Protective antigen
Molecule Role Annotation Immunization with the recombinant GlpQ significantly protected rabbits from subsequent T. pallidum challenge, altering lesion development at the sites of challenge (Cameron et al., 1998).
Related Vaccines(s) T. pallidum GlpQ Protein Vaccine
References