VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Sip

Gene Name Sip
Sequence Strain (Species/Organism) Streptococcus agalactiae A909
VO ID VO_0012402
NCBI Gene ID 3685788
NCBI Protein GI 76788047
Locus Tag SAK_0065
Genbank Accession CP000114
Protein Accession YP_328758
Other Database IDs CDD:212030
CDD:331378
Taxonomy ID 205921
Gene Starting Position 47330
Gene Ending Position 48634
Gene Strand (Orientation) +
Protein Name group B streptococcal surface immunogenic protein
Protein pI 8.59
Protein Weight 40547.64
Protein Length 434
Protein Note Lysine Motif is a small domain involved in binding peptidoglycan; cd00118
DNA Sequence
>NC_007432.1:47330-48634 Streptococcus agalactiae A909, complete genome
AATGAAAATGAATAAAAAGGTACTATTGACATCGACAATGGCAGCTTCGCTATTATCAGTCGCAAGTGTT
CAAGCACAAGAAACAGATACGACGTGGACAGCACGTACTGTTTCAGAGGTAAAGGCTGATTTGGTAAAGC
AAGACAATAAATCATCATATACTGTGAAATATGGTGATACACTAAGCGTTATTTCAGAAGCAATGTCAAT
TGATATGAATGTCTTAGCAAAAATTAATAACATTGCAGATATCAATCTTATTTATCCTGAGACAACACTG
ACAGTAACTTACGATCAGAAGAGTCATACTGCTACTTCAATGAAAATAGAAACACCAGCAACAAATGCTG
CTGGTCAAACAACAGCTACTGTCGATTTGAAAACCAATCAAGTTTCTGTTGCAGACCAAAAAGTTTCTCT
CAATACAATTTCGGAAGGTATGACACCAGAAGCAGCAACAACGATTGTTTCGCCAATGAAGACATATTCT
TCTGCGCCAGCTTTGAAATCAAAAGAAGTATTAGCACAAGGGCAAGCTGTTAGTCAAGCAGCAGCTAATG
AACAGGTATCACCAGCTCCTGTGAAGTCGATTACTTCAGAAGTTCCAGCAGCTAAAGAGGAAGTTAAACC
AACTCAGACGTCAGTCAGTCAGTCAACAACAGTATCACCAGCTTCTGTTGCCGCTGAAACACCAGCTCCA
GTAGCTAAAGTAGCACCGGTAAGAACTGTAGCAGCCCCTAGAGTGGCAAGTGTTAAAGTAGTCACTCCTA
AAGTAGAAACTGGTGCATCACCAGAGCATGTATCAGCTCCAGCAGTTCCTGTGACTACGACTTCAACAGC
TACAGACAGTAAGTTACAAGCGACTGAAGTTAAGAGCGTTCCGGTAGCACAAAAAGCTCCAACAGCAACA
CCGGTAGCACAACCAGCTTCAACAACAAATGCAGTAGCTGCACATCCTGAAAATGCAAGGCTCCAACCTC
ATGTTGCAGCTTATAAAGAAAAAGTAGCGTCAACTTATGGAGTTAATGAATTCAGTACATACCGTGCGGG
AGATCCAGGTGATCATGGTAAAGGTTTAGCAGTTGACTTTATTGTAGGTAAAAACCAAGCACTTGGTAAT
GAAGTTGCACAGTACTCTACACAAAATATGGCAGCAAATAACATTTCATATGTTATCTGGCAACAAAAGT
TTTACTCAAATACAAATAGTATTTATGGACCTGCTAATACTTGGAATGCAATGCCAGATCGTGGTGGCGT
TACTGCCAACCACTATGACCACGTTCACGTATCATTTAACAAATA

Protein Sequence
>YP_328758.1 group B streptococcal surface immunogenic protein [Streptococcus agalactiae A909]
MKMNKKVLLTSTMAASLLSVASVQAQETDTTWTARTVSEVKADLVKQDNKSSYTVKYGDTLSVISEAMSI
DMNVLAKINNIADINLIYPETTLTVTYDQKSHTATSMKIETPATNAAGQTTATVDLKTNQVSVADQKVSL
NTISEGMTPEAATTIVSPMKTYSSAPALKSKEVLAQGQAVSQAAANEQVSPAPVKSITSEVPAAKEEVKP
TQTSVSQSTTVSPASVAAETPAPVAKVAPVRTVAAPRVASVKVVTPKVETGASPEHVSAPAVPVTTTSTA
TDSKLQATEVKSVPVAQKAPTATPVAQPASTTNAVAAHPENARLQPHVAAYKEKVASTYGVNEFSTYRAG
DPGDHGKGLAVDFIVGKNQALGNEVAQYSTQNMAANNISYVIWQQKFYSNTNSIYGPANTWNAMPDRGGV
TANHYDHVHVSFNK

Molecule Role Protective antigen
Molecule Role Annotation Immunization with the recombinant Sip protein efficiently protected CD-1 mice against deadly challenges with six GBS strains of serotypes Ia/c, Ib, II/R, III, V, and VI (Brodeur et al., 2000).
Related Vaccines(s) S. agalactiae Sip Protein Vaccine
References