VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

guaB

Gene Name guaB
Sequence Strain (Species/Organism) Yersinia pestis KIM 10
NCBI Gene ID 1146309
NCBI Protein GI 22125261
Locus Tag y1362
Genbank Accession AE009952
Protein Accession NP_668684
Taxonomy ID 187410
Gene Starting Position 1513261
Gene Ending Position 1514808
Gene Strand (Orientation) +
Protein Name inosine 5'-monophosphate dehydrogenase
Protein pI 6.46
Protein Weight 50099.34
Protein Length 515
Protein Note catalyzes the synthesis of xanthosine monophosphate by the NAD+ dependent oxidation of inosine monophosphate
DNA Sequence
>gi|22123922:1513261-1514808 Yersinia pestis KIM 10 chromosome, complete genome
AGTGCTGGAGGCAATCGATTACGCTCTGTATAATGCCACGGCAATATTTTATCTTTTTCACATTCACCTT
GGTGAGATATTGCCCATGCTACGTATCGCGAAAGAAGCACTAACATTTGATGACGTTCTCCTGGTTCCAG
CCCACTCCACAGTCTTGCCTAACACGGCAGAACTTGGCACTCAACTGACCGCAACTATCCGCCTGAATAT
TCCTATGCTGTCCGCAGCCATGGATACCGTAACCGAATCTCGTCTGGCCATTGCGCTGGCACAAGAAGGC
GGTTTGGGTTTCATTCACAAAAATATGTCCATTGAGCGCCAGGCTGAAGAAGTCAGCCGCGTGAAAAAAC
ATGAAAGTGGCGTTGTTACTGAGCCACAGACTGTTACCCCAACAACGACCCTCCGTCAGGTTAAAGAATT
GACTGCCCGTAACGGTTTTGCCGGGTATCCGGTGGTGACCGAAGATTACGAATTGGTTGGGATCATCACT
GGCCGTGATGTTCGCTTTGTGACTGATTTGGATCAACCGGTGACCGCGGTGATGACACCGAAAGAACGCT
TGGTGACGGTCAAGGAAGGCGAAACCCGCGAAGTTGTGCTGCAAAAAATGCACGAAAAACGTGTAGAGAA
AGTGTTGGTCGTTGATGACAGCTTTCATTTGCGCGGCATGATAACCGTAAAAGATTTCCAAAAAGCAGAA
CGTAAGCCAAATGCCTGTAAAGACGAGCATGGCCGTTTGCGTGTTGGTGCCGCTGTTGGTGCCGGTGCTG
GCAATGAAGAGCGTATCGACGCGCTGGTCGCCGCTGGTGTTGATGTATTACTGATAGACTCCTCTCATGG
TCATTCTGAAGGTGTTCTGCAACGTATCCGTGAAACTCGCGCTAAATATCCTAACTTGCAAATTGTGGGC
GGTAACGTCGCAACCGGTGCTGGGGCGAAAGCGTTGGCAGATGCCGGTGTGAGTGCGGTTAAGGTGGGTA
TCGGCCCAGGTTCAATCTGTACGACGCGCATTGTTACCGGTGTTGGTGTTCCACAGATTACCGCGATTGC
CGATGCTGTTGAAGCACTGGAAGGTACCGGTATTCCGGTTATCGCTGATGGTGGTATCCGTTTCTCCGGC
GATATTGCCAAAGCGATTGCTGCAGGGGCGTCTTGCGTCATGGTCGGTTCTATGTTGGCTGGTACTGAAG
AGTCTCCGGGCGAAATCGAACTGTATCAAGGTCGCTCCTTCAAATCTTACCGTGGCATGGGGTCGCTGGG
CGCGATGTCCAAAGGCTCTTCCGACCGTTACTTCCAAACCGATAATGCGGCCGATAAATTGGTTCCAGAA
GGTATCGAAGGGCGCGTAGCCTACAAAGGCCTGCTGAAAGAGATCGTGCACCAACAAATGGGCGGCCTGC
GTTCTTGCATGGGGCTGACCGGTTGCGGCACTATCAATGAATTGCGCACTAAAGCGGAGTTCGTCCGCAT
CAGTGGTGCCGGCATTCAAGAAAGCCATGTGCATGATGTGACGATTACTAAAGAGTCACCTAATTATCGT
ATGATGTA
Protein Sequence
>gi|22125261|ref|NP_668684.1| inosine 5'-monophosphate dehydrogenase [Yersinia pestis KIM 10]
MLEAIDYALYNATAIFYLFHIHLGEILPMLRIAKEALTFDDVLLVPAHSTVLPNTAELGTQLTATIRLNI
PMLSAAMDTVTESRLAIALAQEGGLGFIHKNMSIERQAEEVSRVKKHESGVVTEPQTVTPTTTLRQVKEL
TARNGFAGYPVVTEDYELVGIITGRDVRFVTDLDQPVTAVMTPKERLVTVKEGETREVVLQKMHEKRVEK
VLVVDDSFHLRGMITVKDFQKAERKPNACKDEHGRLRVGAAVGAGAGNEERIDALVAAGVDVLLIDSSHG
HSEGVLQRIRETRAKYPNLQIVGGNVATGAGAKALADAGVSAVKVGIGPGSICTTRIVTGVGVPQITAIA
DAVEALEGTGIPVIADGGIRFSGDIAKAIAAGASCVMVGSMLAGTEESPGEIELYQGRSFKSYRGMGSLG
AMSKGSSDRYFQTDNAADKLVPEGIEGRVAYKGLLKEIVHQQMGGLRSCMGLTGCGTINELRTKAEFVRI
SGAGIQESHVHDVTITKESPNYRMM
Molecule Role Virmugen
Molecule Role Annotation A guaBA mutant is attenuated in mice and induced significant protection from challenge with wild type Y. pestis (Oyston et al., 2010).
Related Vaccines(s) Yersinia pestis guaBA mutant vaccine
References