VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

guaA

Gene Name guaA
Sequence Strain (Species/Organism) Yersinia pestis KIM 10
NCBI Gene ID 1146310
NCBI Protein GI 22125262
Locus Tag y1363
Genbank Accession AE009952
Protein Accession NP_668685
Taxonomy ID 187410
Gene Starting Position 1514988
Gene Ending Position 1516565
Gene Strand (Orientation) +
Protein Name GMP synthase
Protein pI 5.62
Protein Weight 53362.86
Protein Length 525
Protein Note contains glutamine-hydrolyzing domain and glutamine amidotransferase; GMP-binding domain; functions to produce GMP from XMP in the IMP pathway
DNA Sequence
>gi|22123922:1514988-1516565 Yersinia pestis KIM 10 chromosome, complete genome
CATGACAAAAAATATCCATAAGCATCGCATCCTTATTCTTGATTTCGGCTCGCAGTACACCCAATTATTG
GCGCGTCGTGTGCGTGAGATTGGTGTCTATTGTGAACTATGGGCATGGGATGTCACCGAAGCCCAAATCC
GTGAATTTAATCCAAGTGGTATCATCCTCTCTGGTAGCCCTGAAAGTACGATAGAAAACGGTAGCCCGCG
CGCACCAGACTATGTGTTTACGGCTGGTGTACCGGTGTTGGGTGTGTGCTATGGCATGCAGACCATGGCG
ATACAATTGGGCGGTAAAGTTGAGAGTTCAAATCAGCGTGAATTTGGTTATGCGCAAGTTGAAATTAAAG
CTGACAGCGCGCTGATCCGTGATATCAAAGATGCCATCAATCCGGCAGGCGAAGCCGTATTGGATGTTTG
GATGAGTCACGGTGACAAAGTTGCGGAGATCCCTGCTGATTTTGTCACGGTTGCCAGCACGGATACCTGT
CCGTTTGCCATTATGGCTAACGAAGAAAAACGTTTTTATGGTGTCCAGTTCCATCCTGAAGTGACACACA
CCAAGCAAGGCCTGCGTTTGTTGGAGCGTTTCGTGCTGGGTATCTGTGGCTGCGAAGCGCTATGGACATC
TGCCACCATTATCGAAGATGCAATTGTCCGTTTGCGTGAGCAAATCGGCGACGATCATGTGATCTTGGGG
TTAAGTGGCGGTGTCGACTCTTCAGTGACGGCCATGTTGTTGCACCGCGCTATCGGTAAACGCCTGACCT
GTGTATTCGTGGATAACGGCCTATTACGCTTAAACGAAGCAGATCAGGTCTTGGAAATGTTTGGCGATAA
ATTTGGCCTGAATATTGTCCATGTGGCGGCAGAGGATCGCTTCCTTTCGGCACTGACGGGAGTGGACGAA
CCAGAAGCGAAACGTAAAATCATTGGCCGTGTCTTTGTCGAACTCTTCGACGAAGAAGCCTGTAAACAAG
AGCAGGTGAAATGGTTGGCACAGGGTACGATTTACCCTGATGTGATCGAATCGGCTGCATCAGCTACCGG
TAAAGCGCATGTGATTAAATCTCACCACAATGTGGGCGGTTTGCCAAAAGAGATGAAGCTGGGCCTGGTT
GAGCCGCTGAAAGAGCTGTTTAAAGATGAAGTGCGCAAGATTGGTCTGGAGCTTGGCTTGCCATACGACA
TGCTGTACCGCCATCCTTTCCCAGGGCCGGGCTTAGGTGTGCGCGTATTGGGCGAAGTGAAGAAAGAGTA
TTGCGATTTGCTGCGCCGTGCTGACGCTATCTTTATTGAAGAGCTGCACAAAGCTGATTTGTACAATAAA
GTTAGCCAGGCTTTCACTGTCTTCCTGCCAGTACGTTCAGTCGGTGTGATGGGTGATGGCCGTAAATATG
ATTGGGTTGTCTCTCTGCGTGCGGTAGAGACGGTTGATTTCATGACTGCACATTGGGCACATCTGCCATA
CGACTTCCTTGGCCGCGTTTCAAACCGCATCATTAATGAAGTCAATGGTATCTCGCGCGTAGTTTATGAT
ATCAGCGGCAAGCCACCTGCAACGATTGAGTGGGAATG
Protein Sequence
>gi|22125262|ref|NP_668685.1| GMP synthase [Yersinia pestis KIM 10]
MTKNIHKHRILILDFGSQYTQLLARRVREIGVYCELWAWDVTEAQIREFNPSGIILSGSPESTIENGSPR
APDYVFTAGVPVLGVCYGMQTMAIQLGGKVESSNQREFGYAQVEIKADSALIRDIKDAINPAGEAVLDVW
MSHGDKVAEIPADFVTVASTDTCPFAIMANEEKRFYGVQFHPEVTHTKQGLRLLERFVLGICGCEALWTS
ATIIEDAIVRLREQIGDDHVILGLSGGVDSSVTAMLLHRAIGKRLTCVFVDNGLLRLNEADQVLEMFGDK
FGLNIVHVAAEDRFLSALTGVDEPEAKRKIIGRVFVELFDEEACKQEQVKWLAQGTIYPDVIESAASATG
KAHVIKSHHNVGGLPKEMKLGLVEPLKELFKDEVRKIGLELGLPYDMLYRHPFPGPGLGVRVLGEVKKEY
CDLLRRADAIFIEELHKADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETVDFMTAHWAHLPY
DFLGRVSNRIINEVNGISRVVYDISGKPPATIEWE
Molecule Role Virmugen
Molecule Role Annotation A guaBA mutant is attenuated in mice and induced significant protection from challenge with wild type Y. pestis (Oyston et al., 2010).
Related Vaccines(s) Yersinia pestis guaBA mutant vaccine
References