VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

vicK

Gene Name vicK
Sequence Strain (Species/Organism) Streptococcus equi subsp. zooepidemicus MGCS10565
NCBI Gene ID 6760966
NCBI Protein GI 195978500
Locus Tag Sez_1395
Genbank Accession CP001129
Protein Accession YP_002123744
Taxonomy ID 552526
Gene Starting Position 1433586
Gene Ending Position 1434938
Gene Strand (Orientation) -
Protein Name TCS sensor kinase VicK
Protein pI 5.4
Protein Weight 49245.51
Protein Length 450
Protein Note similar to ref|YP_600051.1| Two-component sensor histidine kinase VicK [Streptococcus pyogenes MGAS2096]
DNA Sequence
>gi|195977156:1433586-1434938 Streptococcus equi subsp. zooepidemicus MGCS10565, complete genome
ATTAATCAATATCATCCTCCCATTCATCATAGATAGCAGCATCCTTTTCATAAGGTAACACAATGGTAAA
GGTTGAGCCCTTGCCATAATCACTCTTAGCCCAAATAAAGCCTCGGTGCTGCTTAATAATTTCTTTAGCA
ATCGCTAGGCCTAGCCCGGTCCCTCCTTGAGCTCTACTCCTAGCCTTATCCACTCGGTAAAAACGGTCAA
AAATCAAAGGCAGGTCCTTTTTTGGAATACCCAAGCCCTCATCAGAAATCGAAATGATTAGCTGGGTATC
TGTTGTTTTCATGTTGACGACAATTTTTCCGCCATCGGGTGAATATTTGATCGCATTGTTTAAAATATTT
TCGATAACCTGCGTCATTTTGTCATCGTCAATTTCTAGCCAAATAGAGGTAATGGGGTAATCTCTGACAA
TTTCATAGGATTTTCCTGTGCTTGTGTGCTGATTTTTCACCAAATCAAAGCGGTTTAAGATAGAGGTCAT
AAAGGCTGTAAAGTTGGTCATTTCAACAGACAGCTGTGTCACATGATTATCAATTCTTGAGAGGTTGAGC
AAATCTGAAATCATGCGCATCATGCGATTGGTTTCATCTAGTGAGACCTTTATAAAGCTTGGAGCGATGT
CCTCCTTTAGCGCGCCCTCATCTAGAGCCTCTAGGTATGACTTGACAGAGGTCAAAGGTGTCCGCAGCTC
ATGGCTAACATTTGAAACAAAGAGTCTGCGCTCGCGCTCTTCCTTTTCCTGCTCAGTCGTGTCATGAAGT
ACAACAACCAGACCTGAAATAAAGCCGCTCTCTCGCCTATTAAGCGCAAAGCGCAGCCGCAGGGAAACAA
ATTCTCCTGTATCATTACGACGGTTTAAGGTCACAATCGGTGTTTTTGAGACCAGCTCTCGGTAGGTATA
AGGGGAGTCACTGTCTAATAAATCTGTAATGTTTTTTTCCAAGGCCTGCTCGCGATTTAAATTGAGCTGC
TTTTGAGCAGTCTCATTAATCATGATAATCTTGCCGGAACGATTGGTCGCAAGGACCCCATCTGTCATAT
AAGCCAAAATACTAGCAAGACGATTTTTTTCTTGAGCAAGGTTTTCATGAGTCAGACGAAAAACATCTGA
TAGGTCATTGAGCTGCTCAGACAGCTCCATCAATTCAATATCAGCCTTTTCATTGATCGTATCAGTATAG
CGACCATTGATCAAATCTCTTATCTTGTGGCTCATCAGACGAATGATCCGAGCATTGCGATAATCACGAA
TGGCTAAATGAATGAAATAAAAAGCAACAAAAACAAGCAATAAGAGTATGGCTAGCTCAAATGCAGAAAG
GTTTCCAATGATGTCCTTAGTCA
Protein Sequence
>gi|195978500|ref|YP_002123744.1| TCS sensor kinase VicK [Streptococcus equi subsp. zooepidemicus MGCS10565]
MTKDIIGNLSAFELAILLLLVFVAFYFIHLAIRDYRNARIIRLMSHKIRDLINGRYTDTINEKADIELME
LSEQLNDLSDVFRLTHENLAQEKNRLASILAYMTDGVLATNRSGKIIMINETAQKQLNLNREQALEKNIT
DLLDSDSPYTYRELVSKTPIVTLNRRNDTGEFVSLRLRFALNRRESGFISGLVVVLHDTTEQEKEERERR
LFVSNVSHELRTPLTSVKSYLEALDEGALKEDIAPSFIKVSLDETNRMMRMISDLLNLSRIDNHVTQLSV
EMTNFTAFMTSILNRFDLVKNQHTSTGKSYEIVRDYPITSIWLEIDDDKMTQVIENILNNAIKYSPDGGK
IVVNMKTTDTQLIISISDEGLGIPKKDLPLIFDRFYRVDKARSRAQGGTGLGLAIAKEIIKQHRGFIWAK
SDYGKGSTFTIVLPYEKDAAIYDEWEDDID
Molecule Role Virmugen
Molecule Role Annotation A vicK mutant is attenuated in mice and induced protection from challenge with wild type S. equi (Liu et al., 2008).
Related Vaccines(s) Streptococcus equi vicK mutant vaccine
References