VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

pcm

Gene Name pcm
NCBI Protein GI 224483370
Other Database IDs CDD:100107
Taxonomy ID 632
Gene Strand (Orientation) ?
Protein Name Pcm
Protein Length 208
Protein Note biovar: Orientalis
Protein Sequence
>gi|224483370|gb|ACN50511.1| Pcm [Yersinia pestis]
MVNKRMQTLLMQLRQQGIHDERLLQAIEAVPRERFVDEALAHKAYENTALPIGAGQTISQPYMVARMTEL
LQLTPTSRVLEIGTGSGYQTAILAHLVDHVCSVERIKGLQWQAKRRLKQLDLHNVSTRHGDGWLGWQSRG
PFDAIIVTAAPPEIPDALLEQLDEGGILVLPVGEQFQTLKYVQRRNNEYHIETVEAVRFVPLVKGELA
Molecule Role Virmugen
Molecule Role Annotation A pcm mutant is highly attenuated in mice and induced significant protection from challenge with wild type Y. pestis (Flashner et al., 2004).
Related Vaccines(s) Yersinia pestis pcm mutant vaccine
References