VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

aroA

Gene Name aroA
NCBI Protein GI 144037
Other Database IDs CDD:179423
CDD:30129
Taxonomy ID 520
Gene Strand (Orientation) ?
Protein Length 442
Protein Note 3-phosphoshikimate 1-carboxyvinyltransferase; Provisional
Protein Sequence
>gi|144037|gb|AAA22968.1| 5-enolpyruvylshikimate-3-phosphate synthase (EC 2.5.1.19) [Bordetella pertussis]
MSGLAYLDLPAARLARGEVALPGSKSISNRVLLLAALAEGSTEITGLLDSDDTRVMLAALRQLGVSVGEV
ADGCVTIEGVARFPTEQAELFLGNAGTAFRPLTAALALMGGDYRLSGVPRMHERPIGDLVDALRQFGAGI
EYLGQAGYPPLRIGGGSIRVDGPVRVEGSVSSQFLTALLMAAPVLARRSGQDITIEVVGELISKPYIEIT
LNLMARFGVSVRRDGWRAFTIARDAVYRGPGRMAIEGDASTASYFLALGAIGGGPVRVTGVGEDSIQGDV
AFAATLAAMGADVRYGPGWIETRGVRVAEGGRLKAFDADFNLIPDAAMTAATLALYADGPCRLRNIGSWR
VKETDRIHAMHTELEKLGAGVQSGADWLEVAPPEPGGWRDAHIGTWDDHRMAMCFLLAAFGPAAVRILDP
GCVSKTFPDYFDVYAGLLAARD
Molecule Role Virmugen
Molecule Role Annotation An aroA mutant is highly attenuated in mice and induces significant protection from challenge with wild type B. pertussis (Roberts et al., 1990).
Related Vaccines(s) Bordetella pertussis aroA mutant vaccine
References