VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

sigE

Gene Name sigE
Sequence Strain (Species/Organism) Mycobacterium tuberculosis H37Rv
NCBI Gene ID 888751
NCBI Protein GI 15608361
Locus Tag Rv1221
Genbank Accession BX842575
Protein Accession NP_215737
Taxonomy ID 83332
Gene Starting Position 1364412
Gene Ending Position 1365185
Gene Strand (Orientation) ?
Protein Name RNA polymerase sigma factor SigE
Protein pI 4.82
Protein Weight 27091.02
Protein Length 257
Protein Note Member of the extracytoplasmic function sigma factors which are active under specific conditions; binds with the catalytic core of RNA polymerase to produce the holoenzyme and directs bacterial core RNA polymerase to specific promoter elements to initiate transcription; in M. tuberculosis this protein is involved in heat shock, oxidative stress and virulence
DNA Sequence
>gi|57116681:1364412-1365185 Mycobacterium tuberculosis H37Rv, complete genome
CATGGAACTCCTCGGCGGACCCCGGGTTGGGAATACGGAATCGCAACTTTGCGTTGCCGACGGTGACGAC
TTGCCAACTTATTGCAGTGCAAATTCGGAGGATCTCAATATCACGACCATCACGACCTTGAGTCCGACCA
GCATGTCTCATCCCCAACAGGTCCGCGATGACCAGTGGGTGGAGCCGTCTGACCAATTGCAGGGCACCGC
CGTATTCGACGCCACCGGGGACAAGGCCACCATGCCGTCCTGGGATGAGCTGGTCCGTCAGCACGCCGAT
CGGGTGTACCGGCTGGCTTATCGGCTCTCCGGCAACCAGCACGATGCCGAAGACCTGACCCAGGAGACCT
TTATCAGGGTGTTCCGGTCGGTCCAGAATTACCAGCCGGGCACCTTCGAAGGCTGGCTACACCGCATCAC
CACCAACTTGTTCCTGGACATGGTCCGCCGCCGGGCTCGCATCCGGATGGAGGCGTTACCCGAGGACTAC
GACCGGGTGCCCGCCGATGAGCCCAACCCCGAGCAGATCTACCACGACGCACGGCTGGGACCTGACCTGC
AGGCTGCCTTGGCCTCGCTGCCGCCGGAGTTTCGTGCCGCGGTGGTGCTGTGTGACATCGAGGGTCTGTC
GTACGAGGAGATCGGCGCCACACTGGGCGTGAAGCTCGGGACGGTACGTAGCCGGATACACCGCGGACGC
CAGGCACTGCGGGACTACCTGGCAGCGCACCCCGAACATGGCGAGTGCGCAGTTCACGTCAACCCAGTTC
GCTG
Protein Sequence
>gi|15608361|ref|NP_215737.1| RNA polymerase sigma factor SigE [Mycobacterium tuberculosis H37Rv]
MELLGGPRVGNTESQLCVADGDDLPTYCSANSEDLNITTITTLSPTSMSHPQQVRDDQWVEPSDQLQGTA
VFDATGDKATMPSWDELVRQHADRVYRLAYRLSGNQHDAEDLTQETFIRVFRSVQNYQPGTFEGWLHRIT
TNLFLDMVRRRARIRMEALPEDYDRVPADEPNPEQIYHDARLGPDLQAALASLPPEFRAAVVLCDIEGLS
YEEIGATLGVKLGTVRSRIHRGRQALRDYLAAHPEHGECAVHVNPVR
Molecule Role Virmugen
Molecule Role Annotation A sigE mutant is highly attenuated in mice and induced significant protection from challenge with wild type M. tuberculosis, more so than the existing vaccine BCG (Hernandez et al., 2010).
Related Vaccines(s) Mycobacterium tuberculosis sigE mutant vaccine
References