VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

fadD26

Gene Name fadD26
Sequence Strain (Species/Organism) Mycobacterium tuberculosis H37Rv
NCBI Gene ID 887603
NCBI Protein GI 57117038
Locus Tag Rv2930
Genbank Accession BX842581
Protein Accession NP_217446
Taxonomy ID 83332
Gene Starting Position 3243696
Gene Ending Position 3245447
Gene Strand (Orientation) ?
Protein Name acyl-CoA synthetase
Protein pI 6.2
Protein Weight 57587.87
Protein Length 583
Protein Note activates fatty acids by binding to coenzyme A
DNA Sequence
>gi|57116681:3243696-3245447 Mycobacterium tuberculosis H37Rv, complete genome
GATGCCGGTGACCGACCGTTCAGTGCCCTCTTTGCTGCAAGAGAGGGCCGACCAGCAGCCTGACAGCACT
GCATATACGTACATCGACTACGGATCCGACCCCAAGGGATTTGCTGACAGCTTGACTTGGTCGCAGGTCT
ACAGTCGTGCATGCATCATTGCTGAAGAACTCAAGTTATGCGGGTTACCCGGAGATCGAGTGGCGGTTTT
AGCGCCACAAGGACTGGAATATGTCCTTGCATTCCTGGGCGCACTTCAGGCTGGATTTATCGCGGTTCCG
CTGTCAACTCCACAGTATGGCATTCACGATGACCGCGTTTCTGCGGTGTTGCAGGATTCCAAGCCGGTAG
CCATTCTCACGACTTCGTCCGTGGTAGGCGATGTAACGAAATACGCAGCCAGCCACGACGGGCAGCCTGC
CCCGGTCGTAGTTGAGGTTGATCTGCTTGATTTGGACTCGCCGCGACAGATGCCGGCTTTCTCTCGTCAG
CACACCGGGGCGGCTTATCTCCAATACACGTCCGGATCGACGCGTACGCCGGCCGGAGTCATTGTGTCGC
ACACGAATGTCATTGCCAATGTGACACAAAGTATGTACGGCTATTTCGGCGATCCCGCAAAGATTCCGAC
CGGGACTGTGGTGTCGTGGCTGCCTTTGTATCACGATATGGGCCTGATTCTCGGAATTTGCGCACCGCTG
GTGGCCCGACGCCGCGCGATGTTGATGAGCCCAATGTCATTTTTGCGCCGTCCGGCCCGCTGGATGCAAC
TGCTTGCCACCAGCGGCCGGTGCTTTTCTGCGGCACCGAATTTCGCCTTCGAGCTGGCCGTGCGCAGAAC
ATCTGACCAGGACATGGCGGGGCTCGACCTGCGCGACGTGGTCGGCATCGTCAGTGGCAGTGAGCGAATC
CATGTGGCAACCGTGCGGCGGTTCATCGAGCGGTTCGCGCCGTACAATCTCAGCCCCACCGCGATACGGC
CGTCGTACGGGCTCGCGGAAGCGACCTTATATGTGGCAGCTCCCGAAGCCGGCGCCGCGCCCAAGACGGT
CCGTTTTGACTACGAGCAGCTGACCGCCGGGCAGGCTCGGCCCTGCGGAACCGATGGGTCGGTCGGCACC
GAACTGATCAGCTACGGCTCCCCCGACCCATCGTCTGTGCGAATCGTCAACCCGGAGACCATGGTTGAGA
ATCCGCCTGGAGTGGTCGGTGAGATCTGGGTGCATGGCGACCACGTGACTATGGGGTATTGGCAGAAGCC
GAAGCAGACCGCGCAGGTCTTCGACGCCAAGCTGGTCGATCCCGCGCCGGCAGCCCCGGAGGGGCCGTGG
CTGCGCACCGGCGACCTGGGCGTCATTTCCGATGGTGAGCTGTTCATCATGGGCCGCATCAAAGACCTGC
TCATCGTGGACGGGCGCAACCACTACCCCGACGACATCGAGGCAACGATCCAGGAGATCACCGGTGGACG
GGCCGCGGCGATCGCAGTGCCCGACGACATCACCGAACAACTGGTGGCGATCATCGAATTCAAGCGACGC
GGTAGTACCGCCGAAGAGGTCATGCTCAAGCTCCGCTCGGTGAAGCGTGAGGTCACCTCCGCGATATCGA
AGTCACACAGCCTGCGGGTGGCCGATCTCGTTCTGGTGTCACCTGGTTCGATTCCCATCACCACCAGCGG
CAAGATCCGGCGGTCAGCCTGCGTCGAACGCTATCGCAGCGACGGCTTCAAGCGGCTGGACGTAGCCGTA
TG
Protein Sequence
>gi|57117038|ref|NP_217446.2| acyl-CoA synthetase [Mycobacterium tuberculosis H37Rv]
MPVTDRSVPSLLQERADQQPDSTAYTYIDYGSDPKGFADSLTWSQVYSRACIIAEELKLCGLPGDRVAVL
APQGLEYVLAFLGALQAGFIAVPLSTPQYGIHDDRVSAVLQDSKPVAILTTSSVVGDVTKYAASHDGQPA
PVVVEVDLLDLDSPRQMPAFSRQHTGAAYLQYTSGSTRTPAGVIVSHTNVIANVTQSMYGYFGDPAKIPT
GTVVSWLPLYHDMGLILGICAPLVARRRAMLMSPMSFLRRPARWMQLLATSGRCFSAAPNFAFELAVRRT
SDQDMAGLDLRDVVGIVSGSERIHVATVRRFIERFAPYNLSPTAIRPSYGLAEATLYVAAPEAGAAPKTV
RFDYEQLTAGQARPCGTDGSVGTELISYGSPDPSSVRIVNPETMVENPPGVVGEIWVHGDHVTMGYWQKP
KQTAQVFDAKLVDPAPAAPEGPWLRTGDLGVISDGELFIMGRIKDLLIVDGRNHYPDDIEATIQEITGGR
AAAIAVPDDITEQLVAIIEFKRRGSTAEEVMLKLRSVKREVTSAISKSHSLRVADLVLVSPGSIPITTSG
KIRRSACVERYRSDGFKRLDVAV
Molecule Role Virmugen
Molecule Role Annotation An fadD26 mutant is attenuated in mice and induced significant protection from challenge with wild type M. tuberculosis (Infante et al., 2005).
Related Vaccines(s) Mycobacterium tuberculosis fadD26 mutant vaccine
References