VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

proC

Gene Name proC
Sequence Strain (Species/Organism) Mycobacterium tuberculosis H37Rv
NCBI Gene ID 887256
NCBI Protein GI 15607641
Locus Tag Rv0500
Genbank Accession BX842573
Protein Accession NP_215014
Taxonomy ID 83332
Gene Starting Position 590082
Gene Ending Position 590969
Gene Strand (Orientation) ?
Protein Name pyrroline-5-carboxylate reductase
Protein pI 4.42
Protein Weight 26600.99
Protein Length 295
Protein Note catalyzes the formation of L-proline from pyrroline-5-carboxylate
DNA Sequence
>gi|57116681:590082-590969 Mycobacterium tuberculosis H37Rv, complete genome
GATGCTTTTCGGCATGGCAAGGATCGCGATTATCGGCGGCGGCAGCATCGGTGAGGCATTGCTGTCGGGT
CTGCTGCGGGCGGGCCGGCAGGTCAAAGACCTGGTAGTGGCCGAGCGGATGCCCGATCGCGCCAACTACC
TGGCGCAGACCTATTCGGTGTTGGTGACGTCGGCGGCCGACGCGGTGGAGAACGCGACGTTCGTCGTCGT
CGCGGTCAAACCAGCCGACGTCGAGCCGGTGATCGCGGATCTGGCGAACGCGACTGCGGCGGCCGAAAAC
GACAGTGCTGAGCAGGTGTTCGTCACCGTGGTAGCGGGCATCACGATCGCGTATTTCGAATCCAAGCTAC
CGGCTGGGACGCCAGTGGTGCGTGCGATGCCGAACGCGGCGGCATTGGTGGGAGCGGGGGTTACAGCGCT
GGCCAAAGGCCGCTTTGTCACCCCGCAACAGCTTGAGGAGGTCTCGGCCTTGTTCGACGCGGTCGGCGGC
GTGCTGACCGTTCCGGAATCGCAGTTGGACGCGGTGACCGCGGTGTCCGGCTCGGGTCCGGCCTATTTCT
TTCTGCTGGTCGAGGCCCTGGTGGATGCCGGAGTCGGGGTGGGCTTGAGCCGTCAGGTGGCCACCGATCT
CGCCGCGCAGACAATGGCTGGCTCAGCGGCGATGCTGCTGGAGCGGATGGAGCAAGACCAGGGTGGCGCC
AATGGCGAGCTGATGGGGCTGCGCGTGGACCTTACCGCATCACGGCTGCGCGCCGCGGTTACCTCGCCGG
GCGGTACGACCGCCGCTGCGCTGCGGGAACTCGAACGCGGCGGGTTTCGGATGGCTGTCGACGCGGCGGT
TCAAGCCGCCAAAAGCCGCTCTGAGCAGCTCAGAATTACACCGGAATG
Protein Sequence
>gi|15607641|ref|NP_215014.1| pyrroline-5-carboxylate reductase [Mycobacterium tuberculosis H37Rv]
MLFGMARIAIIGGGSIGEALLSGLLRAGRQVKDLVVAERMPDRANYLAQTYSVLVTSAADAVENATFVVV
AVKPADVEPVIADLANATAAAENDSAEQVFVTVVAGITIAYFESKLPAGTPVVRAMPNAAALVGAGVTAL
AKGRFVTPQQLEEVSALFDAVGGVLTVPESQLDAVTAVSGSGPAYFFLLVEALVDAGVGVGLSRQVATDL
AAQTMAGSAAMLLERMEQDQGGANGELMGLRVDLTASRLRAAVTSPGGTTAAALRELERGGFRMAVDAAV
QAAKSRSEQLRITPE
Molecule Role Virmugen
Molecule Role Annotation A proC mutant is highly attenuated in mice and induces significant protection from challenge with wild type M. tuberculosis that is equal to the protection induced by the current vaccine BCG (Smith et al., 2001).
Related Vaccines(s) Mycobacterium tuberculosis proC mutant vaccine
References