VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

trpD

Gene Name trpD
Sequence Strain (Species/Organism) Mycobacterium tuberculosis H37Rv
NCBI Gene ID 887681
NCBI Protein GI 15609329
Locus Tag Rv2192c
Genbank Accession BX842579
Protein Accession NP_216708
3D structure: PDB ID 2BPQ
Taxonomy ID 83332
Gene Starting Position 2455630
Gene Ending Position 2456742
Gene Strand (Orientation) -
Protein Name anthranilate phosphoribosyltransferase
Protein pI 6.4
Protein Weight 34267.71
Protein Length 370
Protein Note Catalyzes the conversion of N-(5-phospho-D-ribosyl)-anthranilate and diphosphate to anthranilate and 5-phospho-alpha-D-ribose 1-diphosphate
DNA Sequence
>gi|57116681:2455630-2456742 Mycobacterium tuberculosis H37Rv, complete genome
GTCAGATCTGCCGACCGAACCGCACCCATCGCGCGAGCAACTGTTCGGCCGCACCGGTGTCGATTGCCGC
ACTGGCCCGCCGCAACCCCTCCTCCCAGGCCGGCAGCCATTCAGCACGGCTGGATAATCCGGCGTGGGCG
ACGATCGCACCGGCGGCGTTGAGCACCACAGCGTCCCGGACCGGGCCCCTGGCACCGCCCAACACCGCGC
GCACCGCGGCCGCGTTGGCTTGCGCATCGCCTCCAGCCAGCTGGTCAAGCTGGGCGCGCGCAAACCCGAA
TCCGGCGGGATCAAACGTCAACTTATCCACGCTGCCCGCCGCAACGCGCCAGATCGTGCTCGTGGTGGTG
GTGGTCAACTCGTCCAGCCCATCGTCGCCGTGTACCACCAGCACACTGGACCGGCGCGCAGCAAACACCC
CGGCCATCACTTCGGCGAGGTCGGCGAACGCGCATCCGATCAGTCCAGCCCGGGGCCGGGCCGGATTGGT
CAGCGGCCCGAGAAGATTGAACACGGTGGGCACACCGATCTCGCGGCGTACCGCGGCCGCGTGCCGGTAG
GAGGGATGGAACCGCGGCGCGAAGCAGAACCCGATCCCAACCTCCGCGAGGCTGCGCGCGACCAGGTCGG
GTCCCAGGTCGATGCGCACCCCCAGCGCCTCCAGCGTGTCGGCGCCACCGGACAACGAGGACGCCGCTCG
GTTGCCGTGCTTGACCACCGGCACACCCGCAGCCGCCACCACAATCGCCGCCATGGTGGATAGGTTCACC
GTGTTGACTCCGTCGCCACCGGTGCCGACGACGTCGACGGCGTCGTCGGGGACCGTATCGGCGGGCAACG
GATGCGCGTGGCTGAGCATGACGCCAGCGAGCTCACCGACTTCGTCGGCGGTCGGAGCCTTCATCGTCAT
CGCCACCGCGAAGGCGGCGATCTGCGCCGGCCGCGCATTGCCGGTCATGATCTGGTCCATGGCCCAGGCA
GCCTGGCCCCGCGCCAGATCGCGGTTGTCGGTCAACCGCCCCAAAATCTGCGGCCAGGACGGCACCGATG
CGGCTTCTGCTTTCGGCGAGCCCCCGCGAGATCCCCCCGAAGAACCCTCAGCTGACAGCGCCA
Protein Sequence
>gi|15609329|ref|NP_216708.1| anthranilate phosphoribosyltransferase [Mycobacterium tuberculosis H37Rv]
MALSAEGSSGGSRGGSPKAEAASVPSWPQILGRLTDNRDLARGQAAWAMDQIMTGNARPAQIAAFAVAMT
MKAPTADEVGELAGVMLSHAHPLPADTVPDDAVDVVGTGGDGVNTVNLSTMAAIVVAAAGVPVVKHGNRA
ASSLSGGADTLEALGVRIDLGPDLVARSLAEVGIGFCFAPRFHPSYRHAAAVRREIGVPTVFNLLGPLTN
PARPRAGLIGCAFADLAEVMAGVFAARRSSVLVVHGDDGLDELTTTTTSTIWRVAAGSVDKLTFDPAGFG
FARAQLDQLAGGDAQANAAAVRAVLGGARGPVRDAVVLNAAGAIVAHAGLSSRAEWLPAWEEGLRRASAA
IDTGAAEQLLARWVRFGRQI
Molecule Role Virmugen
Molecule Role Annotation A trpD mutant is highly attenuated in mice and induces more protection from challenge with wild type M. tuberculosis than that induced by the current vaccine BCG (Smith et al., 2001).
Related Vaccines(s) Mycobacterium tuberculosis trpD mutant vaccine
References