VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

drrC

Gene Name drrC
Sequence Strain (Species/Organism) Mycobacterium tuberculosis H37Rv
NCBI Gene ID 888491
NCBI Protein GI 15610075
Locus Tag Rv2938
Genbank Accession BX842581
Protein Accession NP_217454
Taxonomy ID 83332
Gene Starting Position 3274071
Gene Ending Position 3274901
Gene Strand (Orientation) ?
Protein Name daunorubicin-DIM-transport integral membrane protein ABC transporter DrrC
Protein pI 10.46
Protein Weight 26320.25
Protein Length 276
Protein Note Rv2938, (MTCY19H9.06), len: 276 aa. Probable drrC, daunorubicin-DIM-transport integral membrane protein ABC transporter, probably involved in daunorubicin resistance and phthiocerol dimycocerosate transport (see citations below), equivalent to Q9CB71|ML2350 PROBABLE ANTIBIOTIC RESISTANCE MEMBRANE PROTEIN from Mycobacterium leprae (276 aa), FASTA scores: opt: 1434, E(): 1.2e-81, (79.0% identity in 276 aa overlap); and Q49941|DRRC|L518_F3_76 PUTATIVE DAUNORUBICIN RESISTANCE TRANSMEMBRANE PROTEIN from Mycobacterium leprae (244 aa), FASTA scores: opt: 1194, E(): 8.3e-67, (76.85% identity in 242 aa overlap). Also similar to others e.g. Q9XCF9 DRRC PROTEIN from Mycobacterium avium (263 aa), FASTA scores: opt: 538, E(): 3.7e-26, (32.65% identity in 251 aa overlap); Q9S6H3 DAUNORUBICIN RESISTANCE PROTEIN C from Mycobacterium avium (263 aa), FASTA scores: opt: 533, E(): 7.6e-26, (32.25% identity in 251 aa overlap); P32011|DRRB_STRPE DAUNORUBICIN RESISTANCE TRANSMEMBRANE PROTEIN from Streptomyces peucetius (283 aa), FASTA scores: opt: 276, E(): 6.6e-10, (21.07% identity in 261 aa overlap); etc. Note that Rv2938|drrC belongs to the transcriptional unit Rv2930|fadD26-Rv2939|papA5 (proven experimentaly).
DNA Sequence
>gi|57116681:3274071-3274901 Mycobacterium tuberculosis H37Rv, complete genome
CATGATCACGACGACAAGTCAGGAAATCGAGCTTGCACCCACACGTTTGCCAGGCTCGCAAAACGCTGCT
CGGCTGTTCGTTGCGCAGACCCTTTTGCAGACCAACCGGTTGCTAACTCGATGGGCACGTGACTATATCA
CCGTTATCGGAGCGATCGTGTTACCGATTCTCTTCATGGTGGTGTTGAACATTGTGCTAGGTAACCTAGC
TTATGTCGTAACCCACGACAGCGGGCTCTACAGCATTGTTCCGCTGATCGCACTCGGCGCCGCGATCACT
GGGTCAACTTTTGTCGCGATCGACCTGATGCGCGAGCGCTCCTTCGGACTGCTTGCCCGACTGTGGGTGC
TGCCCGTGCACCGAGCATCGGGCCTGATCTCTCGAATCCTGGCAAACGCGATTCGGACTCTGGTCACCAC
TTTAGTGATGCTAGGTACTGGGGTGGTATTGGGTTTCCGGTTTCGACAAGGCCTGATCCCGAGCCTCATG
TGGATTAGTGTCCCGGTGATACTGGGCATCGCAATCGCGGCTATGGTCACTACCGTCGCGCTTTACACAG
CACAAACCGTTGTTGTCGAAGGCGTTGAGCTGGTGCAAGCAATCGCGATCTTCTTCTCCACGGGTTTGGT
GCCGCTCAACTCGTATCCAGGCTGGATTCAGCCGTTCGTCGCCCATCAGCCGGTGAGCTACGCCATCGCG
GCGATGCGCGGTTTTGCAATGGGTGGTCCGGTCCTCTCTCCGATGATCGGGATGCTGGTGTGGACCGCGG
GTATCTGCGTCGTATGCGCCGTACCCTTGGCCATTGGCTACCGACGGGCCAGCACGCATTG
Protein Sequence
>gi|15610075|ref|NP_217454.1| daunorubicin-DIM-transport integral membrane protein ABC transporter DrrC [Mycobacterium tuberculosis H37Rv]
MITTTSQEIELAPTRLPGSQNAARLFVAQTLLQTNRLLTRWARDYITVIGAIVLPILFMVVLNIVLGNLA
YVVTHDSGLYSIVPLIALGAAITGSTFVAIDLMRERSFGLLARLWVLPVHRASGLISRILANAIRTLVTT
LVMLGTGVVLGFRFRQGLIPSLMWISVPVILGIAIAAMVTTVALYTAQTVVVEGVELVQAIAIFFSTGLV
PLNSYPGWIQPFVAHQPVSYAIAAMRGFAMGGPVLSPMIGMLVWTAGICVVCAVPLAIGYRRASTH
Molecule Role Virmugen
Molecule Role Annotation A drrC mutant is highly attenuated in mice and induces significant protection from challenge with wild type M. tuberculosis (Pinto et al., 2004).
Related Vaccines(s) Mycobacterium tuberculosis drrC mutant vaccine
References