VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

panC

Gene Name panC
Sequence Strain (Species/Organism) Mycobacterium tuberculosis H37Rv
NCBI Gene ID 885459
NCBI Protein GI 15610738
Locus Tag Rv3602c
Genbank Accession BX842583
Protein Accession NP_218119
Taxonomy ID 83332
Gene Starting Position 4044280
Gene Ending Position 4045209
Gene Strand (Orientation) -
Protein Name pantoate--beta-alanine ligase
Protein pI 5.96
Protein Weight 29602.42
Protein Length 309
Protein Note catalyzes the formation of (R)-pantothenate from pantoate and beta-alanine
DNA Sequence
>gi|57116681:4044280-4045209 Mycobacterium tuberculosis H37Rv, complete genome
ATCAGTTTCTCCAATGTGATTCGAGGATTGCCCGGTATCCGTCCGGGCGGTCGGTGCCGGCGAAAGTTCC
GATTTCAATCGCAATGTTGTCCAGCAGCCTGGTGGTGCCAAGCCGGGCAGCAACCAGCAGCCGACCGGAA
CCGTTGAGCGGCATCGGGCCAAGCCCGATATCGCGCAGCTCCAGGTAGTCGACCGCCACGCCGGGTGCAG
CGTCGAGCACCGCACGGGCGGCATCCAGCGCGGCCTGCGCGCCAGCCGTTGCCGCATGCGCTGCGGCCGT
TAGCGCCGCCGAGAGCGCGACGGCCGCCGCACGCTGGGCCGGGTCCAGGTAGCGGTTGCGCGACGACATC
GCCAGCCCGTCGGCTTCGCGCACGGTCGGCACGCCGACCACCGCGACATCGAGGTTGAAGTCCGCGACCA
GCTGCCGGATCAGCACCAGCTGCTGGTAGTCCTTCTCACCGAAGAACACCCGATCCGGGCGCACGATCTG
CAGCAGCTTTAGCACGACCGTCAGCACGCCGGCGAAATGGGTTGGCCGCGGGCCGCCCTCGAGTTCGGCG
GCCAACGGACCGGGTTGCACGGTGGTGCGCAGGCCGTCGGGATACATCGCCGCGGTAGTTGGCGTGAAAG
CGATTTCCACGCCTTCGGCCCGCAGTTGCGCCAGGTCGTCGTCCGGGGTGCGGGGATAGGCGTCGAGATC
TTCCCCGGCACCGAATTGCATCGGGTTGACGAAGATCGACACGACGACGACCGATCCGGGCACCCGCTTG
GCCGCACGCACCAACGCGAGGTGGCCTTCGTGCAGCGCACCCATAGTAGGCACCAACATCACTCGCCGGC
CGGTGAGTCGCAGTGCGCGACTGACATCGGCGACATCCCCCGGTGCCGAGTACACATTGAGTTCACCGGG
ATGGAACGCAGGAATCGTCA
Protein Sequence
>gi|15610738|ref|NP_218119.1| pantoate--beta-alanine ligase [Mycobacterium tuberculosis H37Rv]
MTIPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNP
MQFGAGEDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVL
TVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAA
VALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLL
DNIAIEIGTFAGTDRPDGYRAILESHWRN
Molecule Role Virmugen
Molecule Role Annotation A panCD mutant is attenuated in mice and induces significant protection from challenge with wild type M. tuberculosis (Sambandamurthy et al., 2002).
Related Vaccines(s) Mycobacterium tuberculosis panCD mutant vaccine , Mycobacterium tuberculosis RD1/panCD mutant vaccine
References