VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

panD

Gene Name panD
Sequence Strain (Species/Organism) Mycobacterium tuberculosis H37Rv
NCBI Gene ID 885596
NCBI Protein GI 15610737
Locus Tag Rv3601c
Genbank Accession BX842583
Protein Accession NP_218118
Taxonomy ID 83332
Gene Starting Position 4043861
Gene Ending Position 4044280
Gene Strand (Orientation) -
Protein Name aspartate alpha-decarboxylase
Protein pI 4.69
Protein Weight 13595.37
Protein Length 139
Protein Note Converts L-aspartate to beta-alanine and provides the major route of beta-alanine production in bacteria. Beta-alanine is essential for the biosynthesis of pantothenate (vitamin B5)
DNA Sequence
>gi|57116681:4043861-4044280 Mycobacterium tuberculosis H37Rv, complete genome
GCTATCCCACACCGAGCCGGGGGTCTAGCAGCTCGCCCGCGTTTTCGGGCACAAATGCCGGATCGTGGCC
CATGTCGATCGGTTTGTTGTAAGCGTCGACAAACACGATCCGCGGCTGGTATGTGCGGGCCCGGGCGTCG
TCCATCGTCGCGTACGCAATCAGAATCACCAGATCCCCCGGATGCACCAAGTGCGCGGCGGCACCGTTGA
TGCCAATCACACCACTGCCGCGTTCGCCGGTGATCGCGTAGGTGACCAGTCGAGCACCGTTGTCGATATC
GACGATGGTTACCTGTTCGCCTTCCAGCAGGTCGGCGGCGTCCATCAAGTCGGCATCGATGGTCACCGAG
CCGACGTAGTGCAGGTCGGCGCAGGTCACCGTGGCGCGGTGGATCTTCGACTTCAGCATCGTCCGTAACA
Protein Sequence
>gi|15610737|ref|NP_218118.1| aspartate alpha-decarboxylase [Mycobacterium tuberculosis H37Rv]
MLRTMLKSKIHRATVTCADLHYVGSVTIDADLMDAADLLEGEQVTIVDIDNGARLVTYAITGERGSGVIG
INGAAAHLVHPGDLVILIAYATMDDARARTYQPRIVFVDAYNKPIDMGHDPAFVPENAGELLDPRLGVG
Molecule Role Virmugen
Molecule Role Annotation A panCD mutant is attenuated in mice and induces significant protection from challenge with wild type M. tuberculosis (Sambandamurthy et al., 2002).
Related Vaccines(s) Mycobacterium tuberculosis panCD mutant vaccine , Mycobacterium tuberculosis RD1/panCD mutant vaccine
References